| PDBID: | 9if1 | | Status: | HPUB -- hold until publication | | Title: | Unliganded structure of RNA duplex containing UGGAA/UGGAA motif | | Authors: | Mateja-Pluta, M., Kiliszek, A. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9if3 | | Status: | HPUB -- hold until publication | | Title: | Structure of YIUA from Yersinia ruckeri with Iron and DHB-L-Arg-L-Ser | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nck | | Status: | HPUB -- hold until publication | | Title: | Nanotube of computationally designed peptide assembly R3K (16 protofilament) | | Authors: | Das, A., Conticello, V. | | Deposition date: | 2025-02-16 |
|
| PDBID: | 9nce | | Status: | HPUB -- hold until publication | | Title: | Oxidized Treponema pallidum thioredoxin strain Nichols | | Authors: | Carbone, V., Ronimus, R.S., Sutherland-Smith, A.J. | | Deposition date: | 2025-02-16 |
|
| PDBID: | 9ncg | | Status: | HPUB -- hold until publication | | Title: | Marpharsen treated Treponema pallidum thioredoxin strain Nichols | | Authors: | Carbone, V., Ronimus, R.S., Sutherland-Smith, A.J. | | Deposition date: | 2025-02-16 |
|
| PDBID: | 9ncj | | Status: | HPUB -- hold until publication | | Title: | Coiled-coil bundlemer nanotube, R3K (15 proto-filaments) | | Authors: | Das, A., Conticello, V. | | Deposition date: | 2025-02-16 |
|
| PDBID: | 9ncl | | Status: | HPUB -- hold until publication | | Title: | Arsenic treated Treponema pallidum thioredoxin strain Nichols | | Authors: | Carbone, V., Sutherland-Smith, A.J., Ronimus, R.S. | | Deposition date: | 2025-02-16 |
|
| PDBID: | 9ncd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peanut allergen Ara h 9 with bound Fab IGX-3103 and antiFab nanobody | | Authors: | Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-02-15 |
|
| PDBID: | 9if0 | | Status: | HPUB -- hold until publication | | Title: | RNA duplex containing UGGAA/UGGAA motif interacting with NCD molecule | | Authors: | Mateja-Pluta, M., Kiliszek, A. | | Deposition date: | 2025-02-15 |
|
| PDBID: | 9id0 | | Status: | HPUB -- hold until publication | | Title: | XFEL structure of hNQO1 mixed with NADH in a folded orientation at 300 ms | | Authors: | Martin-Garcia, J.M., Quereda-Moraleda, I., Grieco, A., Botha, S. | | Deposition date: | 2025-02-15 |
|
| PDBID: | 9nbu | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | [7,7,5-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (7,7,5) base pairs and 2 nt sticky ends | | Authors: | Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9ic7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of alpha-synuclein fibrils formed in artificial cerebrospinal fluid (aCSF) | | Authors: | Snieckute, R., Sulskis, D., Jocyte, A., Venclovaite, U., Tamulyte, R., Ziaunys, M., Smirnovas, V., Sakalauskas, A. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9ic9 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-04-165 compound of the pyrrolobenzodiazepines class | | Authors: | Di Palma, M., Steiner, R.A. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9nbg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | H-1 Parvovirus VLP - Glycan [s(Lex)2] | | Authors: | Busuttil, K.B., Bennett, A.B., McKenna, R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9ibu | | Status: | HPUB -- hold until publication | | Title: | THE COLLAGEN REPEATING SEQUENCE (PRO-PRO-GLY)10 AT HIGH RESOLUTION | | Authors: | Prange, T., Girard, E., Colloc''h, N., Dhaussy, A.C. | | Deposition date: | 2025-02-13 | | Sequence: | >Entity 1
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
>Entity 2
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
|
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
