PDBID: | 8u2j | Status: | HPUB -- hold until publication | Title: | Crystal structure of human GABARAPL2 soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinolato)Cl] | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | Deposition date: | 2023-09-06 | Release date: | 2025-02-28 |
|
PDBID: | 8u2i | Status: | HPUB -- hold until publication | Title: | Crystal Structure of human GABARAPL2 soaked with RAPTA-C | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | Deposition date: | 2023-09-06 | Release date: | 2025-02-28 |
|
PDBID: | 8u2k | Status: | HPUB -- hold until publication | Title: | Crystal Structure of human GABARAPL1 soaked with RAPTA-C | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | Deposition date: | 2023-09-06 | Release date: | 2025-02-28 |
|
PDBID: | 8u2l | Status: | HPUB -- hold until publication | Title: | Crystal structure of KAI2 S95C L48I mutant | Authors: | Davies, S.F., Waters, M.T., Bond, C.S. | Deposition date: | 2023-09-06 | Sequence: | >Entity 1 GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVIYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGH(OCS)VSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
|
|
PDBID: | 8u2h | Status: | HPUB -- hold until publication | Title: | Crystal structure of human LC3A soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinlinato)Cl] | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | Deposition date: | 2023-09-06 | Release date: | 2025-02-28 |
|
PDBID: | 8qg2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qg3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qg4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qg5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qg6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qg7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qg8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qg9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qga | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgb | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgc | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qge | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgg | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgh | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgi | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgj | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgk | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgl | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgm | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8qgn | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|