| PDBID: | 9qok | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qol | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp6 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp7 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qpa | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nx3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GP232 tail fiber recognition domain from mycobacteriophage Bxz-1 | | Authors: | Di, D., Tsai, J.H., Krieger, I.V., Sacchettini, J.C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of a P. Aeruginosa Gyrase Chimera In Complex with 20mer DNA and Ciprofloxacin | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx5 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a P. Aeruginosa Gyrase | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnm | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2 | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qns | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnn | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnw | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qny | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., KowaleWski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnu | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Nanofitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Douat, C., Huc, I. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnq | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnx | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9u7k | | Status: | HPUB -- hold until publication | | Title: | NMR Solution Structures of MTR-106-MYT1LComplex | | Authors: | Li, Y., Cao, C. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qms | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA-PK bound to 153 bp H2AX nucleosome with ATPyS | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qn6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmr | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i94 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 33 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9d | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 14 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9e | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 18 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 7i9g | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 28 bound to the ph domain of Btk | | Authors: | Brear, P., West, R.M., Nicolescu, R.C.B., Blaszczyk, B.K., Anwar, A., Deingruber, T., Sanders, M.G., Perez-Areales, F.J., Stephens, L.R., Hawkins, P.T., Spring, D.R., Hyvonen, M. | | Deposition date: | 2025-03-24 |
|
