| PDBID: | 9iax | | Status: | HPUB -- hold until publication | | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | | Authors: | Chaplin, A.K., Hall, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H1 Haemagglutinin HN/18 from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mutant H1 Haemagglutinin HN/18-HA FPP from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H1 Haemagglutinin HN/18-HA2-L113S from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n92 | | Status: | HPUB -- hold until publication | | Title: | High-resolution analysis of the human T-cell leukemia virus capsid protein reveals insights into immature particle morphology | | Authors: | Arndt, W.G., Ramezani, A., Talledge, N., Yu, G., Yang, H., Chen, B., Zhang, W., Mansky, L.M., Perilla, J.R. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-051-22 at 1.60 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-10 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9iaa | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 0.81 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of EBOV glycoprotein with modified HR1c (L579P) and HR2 stalk | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9n8f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SUDV glycoprotein with modified HR1c (L579P) and HR2 stalk bound to CA45 Fab | | Authors: | Lee, Y.Z., Ward, A.B., Zhu, J. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9ia9 | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 8.05 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9i9t | | Status: | HPUB -- hold until publication | | Title: | Room-temperature structure of PBP2a at EuXFEL | | Authors: | Grieco, A., Botha, S., Martin-Garcia, J.M. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure containing UGGAA/UGGAA motif interacting with NCD molecule | | Authors: | Mateja-Pluta, M., Kiliszek, A. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9ia3 | | Status: | HPUB -- hold until publication | | Title: | Bc8.108 Fab bound to preS2 peptide | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9x | | Status: | HPUB -- hold until publication | | Title: | Human GABARAP in complex with artificial peptide IM-2 | | Authors: | Wilms, J.A., McDonald, I., Willbold, D., Kritzer, J.A., Weiergraeber, O.H. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9s | | Status: | HPUB -- hold until publication | | Title: | Room temperature structure of PBP2a at the LCLS | | Authors: | Grieco, A., Botha, S., Martin-Garcia, J.M. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9n7n | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C6-AGCT DNA conjugate at 1.82 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7m | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7o | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7u | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C2-AGCT DNA conjugate at 2.17 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9l | | Status: | HPUB -- hold until publication | | Title: | Structure of Far-Red Photosystem I from C. thermalis PCC 7203 | | Authors: | Consoli, G., Tufaill, F., Murray, J.W., Fantuzzi, A., Rutherford, A.W. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9e | | Status: | HPUB -- hold until publication | | Title: | Structure of human Bcl-xL in complex with small molecule inhibitor | | Authors: | Dokurno, P., Novak, T., Kotschy, A., Hubbard, R.E., Davidson, J., Murray, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i94 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 3) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9c | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 29 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i9h | | Status: | HPUB -- hold until publication | | Title: | Structure of FAB-fragment GB11 in complex with Sialyl Lewis A | | Authors: | Freitag, A., Khan-Kilji, S., Nedielkov, R., Murali Kumar, S., Krummhaar, M., Luehle, J., Goerdeler, F., Arndt, J., Kamphues, C., Mroginski, M.A., Roth, C., Seeberger, P.H., Moeller, H.M., Moscovitz, O. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9i93 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 2) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
