| PDBID: | 9s3r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-25 |
|
| PDBID: | 9ps4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9ps5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9ps6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9ps3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9ps2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9ps1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9pre | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of oxidised E.coli DsbA in complex with propiolic acid | | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of E.coli DsbA in-complex with analogue 6 | | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of E.coli DsbA in-complex with analogue 7 | | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9pry | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HIV-1 CA hexamer from purified viral cores, C1 symmetry | | Authors: | Barros dos Santos, N.F., Ganser-Pornillos, B.K., Pornillos, O. | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9prh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of E.coli DsbA in-complex with analogue 8 | | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9pri | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of oxidised E.coli DsbA in-complex with analogue 9 | | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of E.coli DsbA in-complex with analogue 13 | | Authors: | Balaji, G.R., Ilyichova, O.V., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of E.coli DsbA in complex with analogue 17 | | Authors: | Balaji, G., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of E.coli DsbA in complex with analogue 18 | | Authors: | Balaji, G.R., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of E.coli DsbA in complex with analogue 20 | | Authors: | Balaji, G.R., Tasdan, Y., Akhtar, N., Scanlon, M.J. | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9prp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9pru | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-24 | | Release date: | 2026-01-24 | | Sequence: | >Entity 1
AIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSFMNWYQQKPGQPPKLLIYTTSNLESGIPARFSASGSGTDFTLNIHPVEEEDTATYYCQQSNEDPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
QVTLKESGPGILQPSQTLSLTCSFSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKRYNPALKSRLTISKDTSSNQVFLKIASVDTADTATYYCAQINPAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
>Entity 3
RTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDQSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTQLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVQITITQG
|
|
| PDBID: | 9prr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray crystal structure of Streptomyces cacaoi PolF in complex with iron and L-isoleucine | | Authors: | Blancas Cortez, J.J., Boal, A.K. | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9prv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thermostable variant of phosphite dehydrogenase from Pseudomonas stutzeri | | Authors: | Chang, C., Joachimiak, A., Michalska, K., Osipiuk, J., Endres, M., Ping, Y. | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9prq | | Status: | PROC -- to be processed | | Title: | In situ structure of human mitoribosome in the A/T-P state from TACO1-knockout cells | | Authors: | Wang, S., Xiong, Y., Zhang, Y. | | Deposition date: | 2025-07-24 |
|
| PDBID: | 9pro | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
| PDBID: | 9prt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-07-24 | | Release date: | 2026-07-24 |
|
