Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9yl9
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of apo HrmI from Streptomyces griseoflavus
Authors:Pope, S.R., Boal, A.K.
Deposition date:2025-10-08
PDBID:9yl8
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Ni(II)-bound SeMet-HrmI from Streptomyces griseoflavus
Authors:Pope, S.R., Boal, A.K.
Deposition date:2025-10-08
PDBID:9ylc
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of reduced as-isolated Fe(II)Fe(II) Streptomyces griseoflavus HrmI
Authors:Pope, S.R., Boal, A.K.
Deposition date:2025-10-08
PDBID:9yla
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Fe(II)-soaked apo HrmI from Streptomyces griseoflavus
Authors:Pope, S.R., Boal, A.K.
Deposition date:2025-10-08
PDBID:9ylg
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of as-isolated Fe(III)Fe(III) Streptomyces griseoflavus HrmI in complex with L-lysine
Authors:Pope, S.R., Boal, A.K.
Deposition date:2025-10-08
PDBID:9yld
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of reduced as-isolated Fe(II)Fe(II) Streptomyces griseoflavus HrmI in complex with L-lysine
Authors:Pope, S.R., Boal, A.K.
Deposition date:2025-10-08
PDBID:9yl2
Status:AUTH -- processed, waiting for author review and approval
Title:Human Methionine Adenosyltransferase 2A in complex with ddhATP
Authors:Sagatova, A.A., Shin, J.K., Lee, J.H., Wood, J.M., Sidoli, S., Lachowicz, J.L., Harris, L.D., Grove, T.L.
Deposition date:2025-10-08
PDBID:9yl6
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of as-isolated Fe(III)Fe(III) Streptomyces griseoflavus HrmI
Authors:Pope, S.R., Boal, A.K.
Deposition date:2025-10-08
PDBID:9sx9
Status:AUTH -- processed, waiting for author review and approval
Title:Vibrio cholerae competence pilus
Authors:Maggi, S., Kreida, S., Yang, L., Teipen, A.E., Lynch, D.L., Dalia, A.B., Gumbart, J.C., Jensen, G.J.
Deposition date:2025-10-08
Release date:2026-10-08
PDBID:9sx6
Status:AUTH -- processed, waiting for author review and approval
Title:CryoEM structure of the octamer MraZ in complex with 1 box promoter from Mycoplasma genitalium
Authors:Reverter, D., Sanchez-Alba, L., Durand, A.
Deposition date:2025-10-08
Release date:2026-10-08
PDBID:9sx4
Status:AUTH -- processed, waiting for author review and approval
Title:Human fumarylacetoacetate hydrolase (FAH) in complex with HT1.6
Authors:Scarin, R., Rojas, A.L., Millet, O.
Deposition date:2025-10-08
PDBID:9x2r
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of a GRAS protein heterodimer complex
Authors:Wan, L.H., Hu, Y.X.
Deposition date:2025-10-07
PDBID:9ykr
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the GLP (EHMT1) SET domain in complex with SAM and TNG917
Authors:Whittington, D.A.
Deposition date:2025-10-07
PDBID:9yks
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the G9a (EHMT2) SET domain in complex with SAM and TNG917
Authors:Whittington, D.A.
Deposition date:2025-10-07
PDBID:9swu
Status:HPUB -- hold until publication
Title:Crystal structure of NcBBE14
Authors:Bijelic, A., Baldauf, S., Macheroux, P.
Deposition date:2025-10-07
PDBID:9yk1
Status:HPUB -- hold until publication
Title:Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with RNA/DNA duplex
Authors:Kovalevsky, A., Gerlits, O.
Deposition date:2025-10-06
Sequence:

>Entity 1


SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK

>Entity 2


UCGACA

>Entity 3


(DA)(DT)(DG)(DT)(DC)(DG)
PDBID:9yk3
Status:HPUB -- hold until publication
Title:Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex
Authors:Kovalevsky, A., Gerlits, O.
Deposition date:2025-10-06
Sequence:

>Entity 1


SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK

>Entity 2


CGACAU

>Entity 3


(DA)(DT)(DG)(DT)(DC)(DG)
PDBID:9yk5
Status:HPUB -- hold until publication
Title:100K X-ray structure of mixed metal D132N Bacillus halodurans RNase H1 complex with RNA/DNA duplex
Authors:Kovalevsky, A., Gerlits, O.
Deposition date:2025-10-06
Sequence:

>Entity 1


SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK

>Entity 2


UCGACA

>Entity 3


(DA)(DT)(DG)(DT)(DC)(DG)
PDBID:9yk6
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of anti-HCV human neutralizing antibody K595
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2025-10-06
PDBID:9ykd
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of anti-HCV human neutralizing antibody K569
Authors:Nguyen, T.K.Y., Wilson, I.A.
Deposition date:2025-10-06
PDBID:9yjw
Status:AUTH -- processed, waiting for author review and approval
Title:Transferrin Binding Protein A
Authors:Dubey, S., Noinaj, N.
Deposition date:2025-10-05
PDBID:9swc
Status:AUTH -- processed, waiting for author review and approval
Title:Hen egg-white lysozyme structure in LCP medium collected via the Round-Chip method
Authors:Zabelskii, D., Round, A.
Deposition date:2025-10-05
Release date:2026-10-05
PDBID:9sw4
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the MvhAGD-HdrABC dimer of M. marburgensis under state 1 substate a (composite structure)
Authors:San Segundo-Acosta, P., Murphy, B.J.
Deposition date:2025-10-04
PDBID:9sw2
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the MvhAGD-HdrABC dimer of M. marburgensis under state 2 substate a (composite structure)
Authors:San Segundo-Acosta, P., Murphy, B.J.
Deposition date:2025-10-04
PDBID:9sw1
Status:AUTH -- processed, waiting for author review and approval
Title:Human fumarylacetoacetate hydrolase (FAH) in complex with A4
Authors:Scarin, R., Rojas, A.L., Millet, O.
Deposition date:2025-10-04

243531

数据于2025-10-22公开中

PDB statisticsPDBj update infoContact PDBjnumon