PDBID: | 9cwo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo EM structure of Nipah virus L-P polymerase complex | Authors: | Deniston, C., Buffalo, C., Rohaim, A. | Deposition date: | 2024-07-29 |
|
PDBID: | 9gb8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Contracted phiCD508 tail | Authors: | Wilson, J.S., Fagan, R.P., Bullough, P.A. | Deposition date: | 2024-07-29 |
|
PDBID: | 9gax | Status: | AUTH -- processed, waiting for author review and approval | Title: | TEAD1 in comlex with a reversible inhibitor N-[(1S)-2-hydroxy-1-(1-methyl-1H-pyrazol-3-yl)ethyl]-2-methyl-8-[4-(trifluoromethyl)phenyl]-2H,8H-pyrazolo[3,4-b]indole-5-carboxamide | Authors: | Musil, D., Freire, F. | Deposition date: | 2024-07-29 |
|
PDBID: | 9cv7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | LJF-085 Fab in complex with HIV Env ZM233 NFL TD CC3+ trimer | Authors: | Ozorowski, G., Ward, A.B. | Deposition date: | 2024-07-28 |
|
PDBID: | 9cv9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Bufavirus 1 at pH 4.0 | Authors: | Gulkis, M.C., McKenna, R., Bennett, A.D. | Deposition date: | 2024-07-28 |
|
PDBID: | 9cuz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Bufavirus 1 complexed with 6SLN | Authors: | Gulkis, M.C., McKenna, R., Bennett, A.D. | Deposition date: | 2024-07-27 |
|
PDBID: | 9cv0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Bufavirus 1 at pH 7.4 | Authors: | Gulkis, M.C., McKenna, R., Bennett, A.D. | Deposition date: | 2024-07-27 |
|
PDBID: | 9cu9 | Status: | PROC -- to be processed | Title: | Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/L36K at cryogenic temperature | Authors: | Zhang, Y., Schlessman, J.L., Robinson, A.C., Garcia-Moreno E., B. | Deposition date: | 2024-07-26 |
|
PDBID: | 9cux | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SETDB1 Tudor domain in complex with UNC100016 | Authors: | Silva, M., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-07-26 |
|
PDBID: | 9cuw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SETDB1 Tudor domain in complex with UNC100013 | Authors: | Silva, M., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | Deposition date: | 2024-07-26 |
|
PDBID: | 9gad | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Structure and catalytic mechanism of SAM-AMP lyase in Clostridium botulinum CorA-associated type III CRISPR system | Authors: | McMahon, S.A., Gloster, T.M., White, M.F., Graham, S., Chi, H. | Deposition date: | 2024-07-26 |
|
PDBID: | 9gab | Status: | PROC -- to be processed | Title: | Structure and catalytic mechanism of SAM-AMP lyase in Clostridium botulinum CorA-associated type III CRISPR system | Authors: | McMahon, S.A., Chi, H., Gloster, T.M., White, M.F., Graham, S. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure hASF1A 156-cr7 | Authors: | Ochsenbein, F.O., Vitard, A.V. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of human Annexin A4 derived from crystals grown in 40 mM of CaCl2 | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Bifulco, G., Campiglia, P., Sala, M., Scala, M.C., Ruggiero, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of human Annexin A4 derived from crystal grown at 4 mM CaCl2 and retro-soaking | Authors: | Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Scala, M.C., Sala, M., Campiglia, P., Bifulco, G., Ruggiero, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of human Annexin A4 from crystals grown at 4 mM Calcium | Authors: | Ruggiero, A., Barra, G., Ghilardi, O., Scala, M.C., Sala, M., Di Micco, S., Bifulco, G., Campiglia, P., Vitagliano, L. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | MtUvrA2UvrB bound to damaged oligonucleotide | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ga5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | MtUvrA2 bound to endogenous E. coli DNA | Authors: | Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300 | Authors: | Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A. | Deposition date: | 2024-07-26 |
|
PDBID: | 9ix8 | Status: | HPUB -- hold until publication | Title: | Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis | Authors: | Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N. | Deposition date: | 2024-07-26 | Sequence: | >Entity 1 RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
|
|
PDBID: | 9cu7 | Status: | HPUB -- hold until publication | Title: | Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus Hemagglutinin | Authors: | Ouyang, W.O., Pholcharee, T., Wu, N.C. | Deposition date: | 2024-07-25 |
|
PDBID: | 9cu5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | LJF-085 Fab in complex with HIV Env JRFL NFL TD CC3+ trimer and 35O22 Fab | Authors: | Ozorowski, G., Ward, A.B. | Deposition date: | 2024-07-25 |
|
PDBID: | 9ctw | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of SARS-CoV-2 M (long conformation) in the presence of C1P | Authors: | Dolan, K.A., Brohawn, S.G. | Deposition date: | 2024-07-25 |
|
PDBID: | 9cu6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | LJF-034 Fab in complex with HIV Env JRFL NFL TD CC3+ trimer and 35O22 Fab | Authors: | Ozorowski, G., Ward, A.B. | Deposition date: | 2024-07-25 |
|
PDBID: | 9g9u | Status: | AUTH -- processed, waiting for author review and approval | Title: | The structure of XynX, a NIF3 family protein from Geobacillus proteiniphilus T-6 | Authors: | Hadad, N., Pomyalov, S., Lavid, N., Shoham, Y., Shoham, G. | Deposition date: | 2024-07-25 | Release date: | 2025-07-25 |
|