| PDBID: | 9kpb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR2 in apo form | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kpg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR2-arginine | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kp4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human CASTOR1 in apo form | | Authors: | Liu, C., Ding, J., Zhang, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kp8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FAD-dependent oxidase CpaO | | Authors: | Chang, C.Y., Kuo, Y.M., Cheng, T., Liang, C.H., Hsiao, P.Y., Lin, Y.C., Wang, N. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kpc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PRRX2 homeobox domain bound to DNA motif | | Authors: | Dong, C., Yan, X., Huang, Y., Guo, S. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kp1 | | Status: | HOLD -- hold until a certain date | | Title: | Heterodimer of heptaprenyl diphosphate synthase from B. subtilis | | Authors: | Luo, S., Liu, Z.C., Wang, G.G. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hhh | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhg | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhi | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9kos | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of RaTG13 RBD complexed with sheep ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9kow | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of RaTG13 RBD complexed with cattle ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9eg9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human dihydroorotate dehydrogenase in complex with lapachol | | Authors: | Purificacao, A.D., Benz, L.S., Weiss, M.S., Nonato, M.C. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9hgp | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase II in complex with a synthetic aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Huc, I. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9koa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor simnotrelvir | | Authors: | Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9koc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 3C-like protease double mutant (T21I and E166A) in complex with inhibitor ensitrelvir | | Authors: | Nie, T.Q., Su, H.X., Li, M.J., Xu, Y.C. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9ko7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chicken ACE2 | | Authors: | Lan, J., Wang, C.H. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9hge | | Status: | HPUB -- hold until publication | | Title: | PB1 domain of p62/SQSTM1 | | Authors: | Berkamp, S., Jungbluth, L., Katranidis, A., Mostafavi, S., Sachse, C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, CTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eep | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP and succinate | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9een | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
