| PDBID: | 9ndv | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9if6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SUMO E1 with large unit cell parameters in the P1 21 1 space group. | | Authors: | Viloria, M., Francois, R.M.M., Didierjean, C. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and symmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional G/C rich expansion sequence | | Authors: | Shields, E.T., Snow, C.D., Slaughter, C.K. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peanut allergen Ara h 9 with bound Fab IGX-3103 and antiFab nanobody | | Authors: | Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-02-15 |
|
| PDBID: | 9icz | | Status: | HPUB -- hold until publication | | Title: | C-Methyltransferase SeMT from Saccharopolyspora erythraea | | Authors: | Weiergraeber, O.H., Haase, M., Pietruszka, J. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9ibu | | Status: | HPUB -- hold until publication | | Title: | THE COLLAGEN REPEATING SEQUENCE (PRO-PRO-GLY)10 AT HIGH RESOLUTION | | Authors: | Prange, T., Girard, E., Colloc''h, N., Dhaussy, A.C. | | Deposition date: | 2025-02-13 | | Sequence: | >Entity 1
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
>Entity 2
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
|
|
| PDBID: | 9nb0 | | Status: | HPUB -- hold until publication | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and asymmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional expansion sequence | | Authors: | Shields, E.T., Snow, C.D. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9lvn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | | Authors: | Hu, R.K., Feng, C.H. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9iax | | Status: | HPUB -- hold until publication | | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | | Authors: | Chaplin, A.K., Hall, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iat | | Status: | HPUB -- hold until publication | | Title: | Bc8.121 Fab | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lut | | Status: | HPUB -- hold until publication | | Title: | PSI-LHCI supercomplex binding with 4 Lhcas from M. polymorpha | | Authors: | Tsai, P.-C., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luu | | Status: | HPUB -- hold until publication | | Title: | PSI-4 LHCI dimer supercomplex from M. polymorpha | | Authors: | Tsai, P.-C., La Rocca, R., Shen, J.-R., Akita, F. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luw | | Status: | HPUB -- hold until publication | | Title: | Enhancing Monodispersity and Thermal Stability of Human H-Ferritin for Improved Applications in Nanocarrier Systems | | Authors: | Gu, C.K., Wang, S.J. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n97 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8y | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8z | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649, class 2 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
