| PDBID: | 9bie | | Status: | HPUB -- hold until publication | | Title: | human ZYG11B ElonginB/C complex binding to SARS-CoV2 Orf10 protein | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-23 |
|
| PDBID: | 9f03 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | mRhubarb720-WT | | Authors: | Aksakal, O., Rizkallah, P.J., Warren, A., Lipka-Lloyd, M., Jones, D.D. | | Deposition date: | 2024-04-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9bcw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | PawS-Derived Peptides with two disulfide bonds can adopt different structural folds | | Authors: | Hajiaghaalipour, F., Wong, W., Payne, C.D., Fisher, M.F., Clark, R.J., Mylne, J.S., Rosengren, K.J. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9ew9 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Discovery of a Series of Covalent, Cell Active Bfl-1 Inhibitors | | Authors: | Hargreaves, D. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b72 | | Status: | HPUB -- hold until publication | | Title: | Rec2 Domain from G. stearothermophilus Cas9 | | Authors: | D''Ordine, A.M., Belato, H.B., Lisi, G.P., Jogl, G. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9b2b | | Status: | HPUB -- hold until publication | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with a Complete Estrogen Receptor Antagonists that Favors Tetramer Formation | | Authors: | Fink, E.C., Chawla, R., Wells, K.S., Barratt, S., Myles, D.C., Pena, G., Robello, B.W., Ng, R., Fanning, S.W. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 9ay0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GSSG-bound Ycf1 | | Authors: | Soong, T.H., Hotze, C., Raghav, D., Khandelwal, N.K., Tomasiak, T.M. | | Deposition date: | 2024-03-07 | | Release date: | 2025-09-06 |
|
| PDBID: | 9axz | | Status: | HPUB -- hold until publication | | Title: | geranine G-induced 2N4R tau filaments | | Authors: | Malyshka, D., Kuret, J. | | Deposition date: | 2024-03-06 | | Release date: | 2025-09-05 | | Sequence: | >Entity 1
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
|
|
| PDBID: | 8vxg | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vxi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of sitosterol-bound CYP125MRCA | | Authors: | Doherty, D.Z., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 8vrp | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | | Authors: | Goldstone, D.C., Walsham, L. | | Deposition date: | 2024-01-22 | | Release date: | 2025-07-21 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8vqs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Dehaloperoxidase B in complex with substrate cyclohexene | | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqt | | Status: | HPUB -- hold until publication | | Title: | Cryatal structure of Dehaloperoxidase B in complex with substrate 1-methyl-cyclohexene | | Authors: | de Serrano, V.S., Yun, D., Ghiladi, R.A. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Dehaloperoxidase B in complex with substrate 1,4-cyclohexadiene | | Authors: | de Seerano, V.S., Yun, D., Ghiladi, R.A. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8rkm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Single chain shwanavidin-linker-shwanavidin (F43A) | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2023-12-27 |
|
| PDBID: | 8rkk | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Single chain Shwanavidin-linker-Shwanavidin | | Authors: | Livnah, O., Avraham, O., Gutman, D. | | Deposition date: | 2023-12-26 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8r77 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Ficin C crystal form 2 | | Authors: | Loris, R., Baeyens-Volant, D., Azarkan, M., Kerff, F. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 8qza | | Status: | HPUB -- hold until publication | | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | | Deposition date: | 2023-10-26 | | Release date: | 2025-07-26 |
|
| PDBID: | 8ugx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of Prefusion-stabilized RSV F (DS-Cav1, M16 strain) in complex with Fab 2M03 | | Authors: | Xian, Y., Harshbarger, W.D. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 7r2n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | elongated Cascade complex from type I-A CRISPR-Cas system in an active state | | Authors: | Hu, C., Ni, D., Nam, K.H., Terns, M., Stahlberg, H. | | Deposition date: | 2022-02-04 |
|
| PDBID: | 7n9m | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(13) | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 7n9n | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with Aliphatic SERD S-C10(14) | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 7n9p | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with ICI164,384 | | Authors: | Diennet, M., El Ezzy, M., Thiombane, K., Cotnoir-White, D., Poupart, J., Gao, Z., Mendoza, S.R., Marinier, A., Gleason, J., Mader, S.C., Fanning, S.W. | | Deposition date: | 2021-06-18 |
|
| PDBID: | 2m95 | | Status: | POLC -- waiting for a policy decision | | Title: | Ferredoxin Competes with Bacterial Frataxin in Binding to the Desulfurase IscS | | Authors: | Konarev, P.V., Iannuzzi, C., Adinolfi, S., Roche, B., Kelly, G., Simon, L., Martin, S.R., Py, B., Barras, F., Svergun, D.I. | | Deposition date: | 2013-06-03 |
|
