| PDBID: | 9lya | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PAS domain in NreB protein | | Authors: | Xia, Y., Xun, L., Tang, C. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ifk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with DK-2 | | Authors: | Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifv | | Status: | HPUB -- hold until publication | | Title: | PARP15 catalytic domain mutant (R576E) in complex with 3-aminobenzamide | | Authors: | Ebenwaldner, C., Logan, D.T., Schuler, H., Moche, M. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ife | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z943693514 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ig1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with DK-652 | | Authors: | Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifn | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z436190540 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9iff | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2856434836 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifg | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2204875953 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifh | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2856434890 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifi | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z32399802 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifj | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z2017861827 | | Authors: | Exertier, C., Fiorillo, A., Ilari, A., Antonelli, L. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifl | | Status: | HPUB -- hold until publication | | Title: | PANDDA analysis - Crystal structure of Trypanosoma brucei trypanothione reductase in complex with Z319545618 | | Authors: | Exertier, C., Antonelli, L., Ilari, A., Fiorillo, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndd | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer, combined core plus aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndv | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndw | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of core | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndx | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) refinement of aptamer and core | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9if6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SUMO E1 with large unit cell parameters in the P1 21 1 space group. | | Authors: | Viloria, M., Francois, R.M.M., Didierjean, C. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and symmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional G/C rich expansion sequence | | Authors: | Shields, E.T., Snow, C.D., Slaughter, C.K. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9ncd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peanut allergen Ara h 9 with bound Fab IGX-3103 and antiFab nanobody | | Authors: | Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-02-15 |
|
| PDBID: | 9icz | | Status: | HPUB -- hold until publication | | Title: | C-Methyltransferase SeMT from Saccharopolyspora erythraea | | Authors: | Weiergraeber, O.H., Haase, M., Pietruszka, J. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9ibu | | Status: | HPUB -- hold until publication | | Title: | THE COLLAGEN REPEATING SEQUENCE (PRO-PRO-GLY)10 AT HIGH RESOLUTION | | Authors: | Prange, T., Girard, E., Colloc''h, N., Dhaussy, A.C. | | Deposition date: | 2025-02-13 | | Sequence: | >Entity 1
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
>Entity 2
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
|
|
| PDBID: | 9nb0 | | Status: | HPUB -- hold until publication | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and asymmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional expansion sequence | | Authors: | Shields, E.T., Snow, C.D. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
