| PDBID: | 9ktk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human SIRT3 with its activator SKLB-11A | | Authors: | Ouyang, L., Wu, C.Y. | | Deposition date: | 2024-12-02 | | Release date: | 2025-12-02 |
|
| PDBID: | 9ktn | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of SARS-CoV-2 nsp10-nsp16 methyltransferase complex with MI54 | | Authors: | Cao, L., Xu, T.F., Yan, L.M., Yang, S.D., Zhang, H.W., Ji, Y.X., Ge, J., Fan, S.L., Li, C.M., Rao, Z.H., Lou, Z.Y., Guo, D.Y. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1 | | Authors: | Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ek9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the mutant (R140Q) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9eki | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Michaelis complex of the mutant (R140Q) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ekj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mutant (R140Q) IDH2 homodimer in complex with clonixin | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ekl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Michaelis complex of the mutant (R140Q, I319M) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ekn | | Status: | HPUB -- hold until publication | | Title: | Thomasclavelia ramosa Immunoglobulin A Protease Middle (Protease) Domain with C-terminal Domain #1 (Metal Chelated and Zinc Supplemented) | | Authors: | Tran, N., Frenette, A., Holyoak, T. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9eka | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CRISPR-associated deaminase Cad1 in Apo form | | Authors: | Zhao, Y., Whyms, C.T., Li, H. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt4 | | Status: | HPUB -- hold until publication | | Title: | complex structure of methyltransferases SMYD2 and inhibitor (003) | | Authors: | Lu, J., Sun, Y.L., Lu, W.C., Cao, L.H., Liu, Y.H. | | Deposition date: | 2024-12-01 |
|
| PDBID: | 9ksd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 1), with 44-mer mRNA, RfaH, NusA, fMet-tRNA(fMet), IF1, IF2, IF3. | | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9ksc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 1), with 44-mer mRNA, RfaH, fMet-tRNA(fMet), IF-1, IF-2, IF-3. | | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9ksf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 2), with 56-mer mRNA, RfaH, NusA, fMet-tRNA(fMet), IF-1, IF-2, IF-3. | | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9kse | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RfaH-mediated transcription-coupled translation pre-initiation complexes (state 3), with 32-mer mRNA, RfaH, fMet-tRNA(fMet), IF-1, IF-2, IF-3. | | Authors: | Lu, G., Zhang, J., Wang, C., Lin, J. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9ejw | | Status: | HPUB -- hold until publication | | Title: | MCMV immunoevasin m11 binding murine CD44 | | Authors: | Deuss, F.A., Rossjohn, J., Sng, X.Y.X., Voigt, V., Schuster, I.S., Fleming, P., Abuwarwar, M., van Dommelen, S., Neate, G., Horsnell, H.L., Golzarroshan, B., Varelias, A., Hill, G.R., Lyman, S.D., Mueller, S.N., Scalzo, A.A., Wikstrom, M.E., Berry, R., Fletcher, A.L., Andoniou, C.E., Degli-Esposti, M.A. | | Deposition date: | 2024-11-29 |
|
| PDBID: | 9hj9 | | Status: | HPUB -- hold until publication | | Title: | H1-H3 chimeric hemagglutinin | | Authors: | Seraj, N., Harshbarger, W., Mallett, C.P., Vassilev, V. | | Deposition date: | 2024-11-28 | | Sequence: | >Entity 1
APLQLGNCSVAGWILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPKESSWPNHTQNGGSNSCSHNGESSFYKNLLWLTKSGSLYPNLSKSYANNKEKEVLVLWGVHHPPTIQEQTSLYVKENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLLEPGDTIIFEANGNLIAPRYAFALSRGSGLVPRGSGHHHHHH
>Entity 2
MGCVAETGQVQLEESGPGLVKPSETLSLTCSVSGVSVTSDIYYWTWIRQPPGKGLEWIGYIFYNGDTNYNPSLKSRVTMSIDTSKNEFSLRLTSVTAADTAVYFCARGTEDLGYCSSGSCPNHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
>Entity 3
MGCVAETGDIVMTQSPSSLSASIGDRVTITCRPSQNIRSFLNWFQHKPGKAPKLLIYAASNLQSGVPSRFSGSGSGTEFTLTIRSLQPEDFATYYCQQSYNTPPTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 9hiy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CAK (CDK7 D97N mutant) in complex with ATPgS | | Authors: | Cushing, V.I., Greber, B.J., Ali, S., Lai, C.-F., Bevan, C.L., Coombes, R.C., Buluwela, L. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9hj0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CAK (CDK7 D97N mutant) in complex with Samuraciclib | | Authors: | Cushing, V.I., Greber, B.J., Ali, S., Lai, C.-F., Bevan, C.L., Coombes, R.C., Buluwela, L. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9hix | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CAK (CDK7 D97N mutant) in complex with THZ1 | | Authors: | Cushing, V.I., Greber, B.J., Ali, S., Lai, C.-F., Bevan, C.L., Coombes, R.C., Buluwela, L. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9kqy | | Status: | HPUB -- hold until publication | | Title: | The co-crystal structure of DYRK2 with YK-3-18E | | Authors: | Tong, C. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9ej7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of the mutant (R140Q and I319M) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9hio | | Status: | HPUB -- hold until publication | | Title: | RKEC1 DNA aptamer bound to dopamine | | Authors: | Largy, E., Kaiyum, Y.A., Chao, E.H.P., Vialet, B., Johnson, P.E., Mackereth, C.D. | | Deposition date: | 2024-11-26 | | Sequence: | >Entity 1
(DT)(DT)(DG)(DA)(DA)(DG)(DG)(DT)(DT)(DC)(DG)(DT)(DT)(DC)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DT)(DG)(DG)(DA)(DG)(DT)
|
|
| PDBID: | 9hi0 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX04 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hi1 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COMPOUND WBX09 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
| PDBID: | 9hi2 | | Status: | HOLD -- hold until a certain date | | Title: | STRUCTURE OF HUMAN UDP-GALACTOSE 4-EPIMERASE IN COMPLEX WITH COVALENT COMPOUND WBC10 | | Authors: | Mouilleron, S., Schumann, B., Browne, W., Purkiss, A., Weckwerth, T., Ogrodowicz, R., Prema, R., Kunzelmann, S., Roustan, C. | | Deposition date: | 2024-11-22 | | Release date: | 2025-11-22 |
|
