| PDBID: | 9m2a | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the trypanosome alternative oxidase complexed with a trypanocidal phosphonium derivative (compound1) | | Authors: | Ebiloma, G.U., Balogun, E.O., Dardonville, C., De Koning, H.P., Shiba, T. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9njh | | Status: | HPUB -- hold until publication | | Title: | Translocated product complex of DNA polymerase iota with DNA (template A) | | Authors: | Frevert, Z., Freudenthal, B., Washington, M.T. | | Deposition date: | 2025-02-27 |
|
| PDBID: | 9m1x | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human heart fatty acid-binding protein at 0.80 A resolution (holo-FABP3) | | Authors: | Sugiyama, S., Maekawa, S., Matsuoka, S., Murata, M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nin | | Status: | HPUB -- hold until publication | | Title: | The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86 | | Authors: | Cartwright, J.J., Abiodun, W.O., Dass, R., Singleton, J.D., Doukov, T., Peterson, M.A., Moody, J.D. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nij | | Status: | HPUB -- hold until publication | | Title: | Structure of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nik | | Status: | HPUB -- hold until publication | | Title: | Structure of E1277A mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nil | | Status: | HPUB -- hold until publication | | Title: | Structure of a Y1216F mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M., Barrera Ramirez, J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nim | | Status: | HPUB -- hold until publication | | Title: | Structure of a K1305A mutant of the acyltransferase domain of NcdE, a multi-domain NRPS protein from nocardichelin biosynthesis | | Authors: | Fisk, M.B., Gulick, A.M., Barrera Ramirez, J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9niw | | Status: | HPUB -- hold until publication | | Title: | Fab1550 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9niy | | Status: | HPUB -- hold until publication | | Title: | Fab1393 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj4 | | Status: | HPUB -- hold until publication | | Title: | Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9m0m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a thermophilic family II inorganic pyrophosphatase in Thermodesulfobacterium commune | | Authors: | Maruoka, S., Teramoto, T., Watanabe, K., Kakuta, Y. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9nhy | | Status: | HPUB -- hold until publication | | Title: | Fab1502 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni1 | | Status: | HPUB -- hold until publication | | Title: | Fab389 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9ni2 | | Status: | HPUB -- hold until publication | | Title: | Fab369 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8m | | Status: | HPUB -- hold until publication | | Title: | VPS35-VPS26-SNX12 Complex | | Authors: | Pardo, M., Rojas, A.L., Hierro, A. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hsp82-MD in complex with the CS domain of Sgt1 | | Authors: | Lopez, A., Napolitano, V., Delhommel, F., Popowicz, G.M., Sattler, M. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8r | | Status: | HPUB -- hold until publication | | Title: | Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
|
|
| PDBID: | 9q8t | | Status: | HPUB -- hold until publication | | Title: | Nociceptive properties of U5-theraphotoxin-Hs1b, a novel peptide from the Cyriopagopus schmidti spider, active on NaV1.7 channel | | Authors: | Meudal, H., Landon, C. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8x | | Status: | HPUB -- hold until publication | | Title: | Ku70/80 bound to a 153 bp H2AX nucleosome | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8p | | Status: | HPUB -- hold until publication | | Title: | Structure characterization and anticancer potential of the fungal immunomodulatory protein FIP-ach | | Authors: | Wszolek, A., Patel, S.N., Dubin, G. | | Deposition date: | 2025-02-25 |
|
| PDBID: | 9q8u | | Status: | HPUB -- hold until publication | | Title: | Complex of Caprine Serum Albumin with Cefaclor | | Authors: | Duszynski, K., Talaj, J.A., Bujacz, A., Bujacz, G. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
DTHKSEIAHRFNDLGEENFQGLVLIAFSQYLQQCPFDEHVKLVKELTEFAKTCVADESHAGCDKSLHTLFGDELCKVATLRETYGDMADCCEKQEPERNECFLKHKDDSPDLPKLKPEPDTLCAEFKADEKKFWGKYLYEVARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKADFTDVTKIVTDLTKVHKECCHGDLLECADDRADLAKYICDHQDTLSSKLKECCDKPVLEKSHCIAEIDKDAVPENLPPLTADFAEDKEVCKNYQEAKDVFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEDCCAKEDPHACYATVFDKLKHLVDEPQNLIKKNCELFEKHGEYGFQNALIVRYTRKAPQVSTPTLVEISRSLGKVGTKCCAKPESERMPCTEDYLSLILNRLCVLHEKTPVSAKVTKCCTESLVNRRPCFSDLTLDETYVPKPFDGESFTFHADICTLPDTEKQIKKQTALVELLKHKPKATDEQLKTVMENFVAFVDKCCAADDKEGCFLLEGPKLVASTQAALA
|
|
| PDBID: | 9nh5 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable H2A* SUBSTRATE PRE-MRNA (core region) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nh6 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable mH2A* SUBSTRATE PRE-MRNA (COMPOSITE MAP) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-24 |
|
