| PDBID: | 9ci4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH (Apo form) | | Authors: | Wanniarachchi, T.N., Bruner, S.D. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fxz | | Status: | HPUB -- hold until publication | | Title: | Galectin-8 N-terminal carbohydrate recognition domain in complex with 4-(bromophenyl)phthalazinone D-galactal ligand | | Authors: | Van Klaveren, S., Hakansson, M., Diehl, C., Nilsson, N.J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9ill | | Status: | HPUB -- hold until publication | | Title: | monomeric SarA-E89Q in complex with DNA | | Authors: | Xia, B., Fu, D.H. | | Deposition date: | 2024-06-30 | | Release date: | 2025-09-30 |
|
| PDBID: | 9ilk | | Status: | HPUB -- hold until publication | | Title: | monomeric SarA, truncation of residue 20-124 | | Authors: | Xia, B., Fu, D.H. | | Deposition date: | 2024-06-30 | | Release date: | 2025-09-30 |
|
| PDBID: | 9cf5 | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF CD4 MIMETIC CJF-III-288 IN COMPLEX WITH BG505 SOSIP.664 HIV-1 ENV TRIMER AND 17B FAB | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9ijx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse Spef1 coiled-coil domain | | Authors: | Ren, J., Li, D., Feng, W. | | Deposition date: | 2024-06-25 | | Sequence: | >Entity 1
GPGSYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR
|
|
| PDBID: | 9c9n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH in complex with nickel and succinate | | Authors: | Wanniarachchi, T.N., Bruner, S.D. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9c30 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of JF1cpCasp2 in complex with peptide inhibitor AcVDV(Dab)D-CHO | | Authors: | Fuller, J.L., Shi, K. | | Deposition date: | 2024-05-31 | | Release date: | 2025-11-30 |
|
| PDBID: | 8zog | | Status: | HPUB -- hold until publication | | Title: | Structure of the astaxanthin mutant PSI-9VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zoa | | Status: | HPUB -- hold until publication | | Title: | Structure of the wild-type PSI-8VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zob | | Status: | HPUB -- hold until publication | | Title: | Structure of the wild-type PSI-5VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zoc | | Status: | HPUB -- hold until publication | | Title: | Structure of the canthaxanthin mutant PSI-9VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zod | | Status: | HPUB -- hold until publication | | Title: | Structure of the canthaxanthin mutant PSI-5VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zoe | | Status: | HPUB -- hold until publication | | Title: | Structure of the canthaxanthin mutant PSI-4VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zof | | Status: | HPUB -- hold until publication | | Title: | Structure of the canthaxanthin mutant PSI-3VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Li, Z.H., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zoh | | Status: | HPUB -- hold until publication | | Title: | Structure of the astaxanthin mutant PSI-7VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 8zoi | | Status: | HPUB -- hold until publication | | Title: | Structure of the astaxanthin mutant PSI-5VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 | | Release date: | 2025-11-28 |
|
| PDBID: | 9c19 | | Status: | HPUB -- hold until publication | | Title: | Structure of human LIAS | | Authors: | Esakova, O.A., Warui, D.M., Neti, S.S., Alumasa, J.N., Booker, S.J. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 9bwl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp in complex with butyryl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetyl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of polyketoacyl-CoA thiolase from Burkholderia sp. in complex with acetoacetyl-coA | | Authors: | Pereira, J.H., Wang, Z., Keasling, J.D., Adams, P.D. | | Deposition date: | 2024-05-21 |
|
| PDBID: | 8zl7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Os ALDH2C4 (cytosolic aldehyde dehydrogenase) in complex with NADH | | Authors: | Wang, Y., Wang, W.M., Song, Z.D. | | Deposition date: | 2024-05-17 | | Release date: | 2025-11-17 |
|
| PDBID: | 8zbx | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of aldehyde dehydrogenase 2C4 (Os ALDH2C4) from Oryza sativa L. | | Authors: | Wang, Y., Wang, W.M., Song, Z.D. | | Deposition date: | 2024-04-28 | | Release date: | 2025-10-28 |
|
| PDBID: | 9bj8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | human CRL2-ZYG11B complex | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9bj9 | | Status: | HOLD -- hold until a certain date | | Title: | Human CRL-2 ZYG11B binding to human NLRP1 Gly/N degron | | Authors: | Liu, X., Gross, J.D. | | Deposition date: | 2024-04-25 |
|
