| PDBID: | 8qs2 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs3 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs4 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs6 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qql | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human inward-rectifier potassium 2.1 channel (Kir2.1) - R312H mutant | | Authors: | Fernandes, C.A.H., Zuniga, D., Venien-Bryan, C. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed metal-controlled heterodimer of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G MCHeT_A + MCHeT_C | | Authors: | Mealka, M., Maniaci, B., Stec, B., Huxford, T. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8qq9 | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 1-benzyl-3-(1-hydroxy-3,4-dihydro-1H-benzo[c][1,2]oxaborinin-7-yl)thiourea | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-04 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8qp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2023-09-30 | | Sequence: | >Entity 1
MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2
EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 8qp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E2 glycoprotein epitopeI 411-424 scaffold design 4CIL_04 | | Authors: | Nagarathinam, K., Cramer, J.T., Krey, T. | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8uds | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Crystal Structure of CoxG from M. smegmatis, minus lipid anchoring C-terminus. | | Authors: | Rhys, R., Kropp, A. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8qog | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the yeast SPT-Orm2-Monomer complex | | Authors: | Schaefer, J., Koerner, C., Moeller, A., Froehlich, F. | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 8wke | | Status: | HPUB -- hold until publication | | Title: | Sulfate-bound SARS-CoV-2 Nsp9 | | Authors: | Chen, P.J., Huang, H.Y., Hsiao, W.C., Huang, C.Y. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 8wkf | | Status: | HPUB -- hold until publication | | Title: | Rational Design of Highly Selective PDE5 inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis | | Authors: | Zhang, F.C, Huang, Y.Y | | Deposition date: | 2023-09-27 |
|
| PDBID: | 8wkg | | Status: | HPUB -- hold until publication | | Title: | Rational Design of Highly Selective PDE5 inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis | | Authors: | Zhang, F.C., Huang, Y.Y. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 8wjx | | Status: | HPUB -- hold until publication | | Title: | ADP-bound purinergic receptor 1 in complex with miniGs/q | | Authors: | Gu, Q.C., Tang, W.Q. | | Deposition date: | 2023-09-26 |
|
| PDBID: | 8ubs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NrdJ-1 split intein fusion | | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8qmj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with hexa-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ub4 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cdc48-Shp1 unfolding native substrate, consensus structure | | Authors: | Cooney, I., Schubert, H.L., Cedeno, K., Carson, R., Fisher, O.N., Price, J.C., Hill, C.P., Shen, P.S. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh4 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer ssDNA bound apo conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MPOX E5 hexamer ssDNA and AMP-PNP bound conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wgz | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 double hexamer ssDNA bound conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh6 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer ADP and ssDNA bound and clear primase domain conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh2 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer 2ATP, 2ADP, and ssDNA binding comformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wgy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MPOX E5 hexamer AMP-PNP and ssDNA bound form with clear primase domain | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh3 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer apo form | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
