| PDBID: | 9mkb | | Status: | HPUB -- hold until publication | | Title: | Structure of the bacteriophage T4 portal-neck-tail complex | | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9hqt | | Status: | HPUB -- hold until publication | | Title: | SFX structure of cytochrome c prime beta from Methylococcus capsulatus (Bath) | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l2o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure and rational engineering of a novel efficient ochratoxin A-detoxifying amidohydrolase | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l2t | | Status: | HPUB -- hold until publication | | Title: | Cryo-electron microscopic structure of a novel amidohydrolase with three mutations | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9l36 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-electron microscopic structure of a novel amidohydrolase ADH3 triple mutation | | Authors: | Dai, L.H., He, B.Y., Hu, Y.M., Xu, Y.H., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9mka | | Status: | HPUB -- hold until publication | | Title: | Gallid alphaherpesvirus-1 large tegument protein NLS 1 in complex with Importin alpha | | Authors: | Nath, B.K., Swarbrick, C.M.D., Sarker, S., Forwood, J.K. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Shaw, J.M., Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of meropenem bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of avibactam bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqh | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 28-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqf | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 7-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 | | Sequence: | >Entity 1
GGSSGSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
|
|
| PDBID: | 9hpo | | Status: | HPUB -- hold until publication | | Title: | Docedameric RuvBL1/RuvBL2 | | Authors: | Santo, P.E., Plisson-Chastang, C. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9l0p | | Status: | HPUB -- hold until publication | | Title: | Structure of R&R Chitin-binding domain bound to Chitin. | | Authors: | Hu, S.F., Li, J., Shi, C.W. | | Deposition date: | 2024-12-12 |
|
| PDBID: | 9mik | | Status: | HPUB -- hold until publication | | Title: | Gallid alphaherpesvirus-1 large tegument protein bipartite NLS2 in complex with Importin alpha | | Authors: | Nath, B.K., Swarbrick, C.M.D., Sarker, S., Forwood, J.K. | | Deposition date: | 2024-12-12 |
|
| PDBID: | 9mhq | | Status: | HPUB -- hold until publication | | Title: | G169V variant of Streptomyces coelicolor coproheme decarboxylase in complex with Monovinyl, Monopropionate Deuteroheme | | Authors: | Carriuolo, A.C., Lanzilotta, W.N. | | Deposition date: | 2024-12-12 |
|
| PDBID: | 9ho1 | | Status: | HPUB -- hold until publication | | Title: | Room temperature structure of Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2-oxoglutarate, and hydroxylated Factor X derived peptide fragment, 1.5 s O2 exposure | | Authors: | de Munnik, M., Rabe, P., Brewitz, L., Brasnett, A., Zhou, T., Schofield, C.J., Kern, J.F. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9ho3 | | Status: | HPUB -- hold until publication | | Title: | Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2OG, nitric oxide, and Factor X peptide fragment | | Authors: | de Munnik, M., Rabe, P., Brasnett, A., Brewitz, L., Schofield, C.J. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9ho2 | | Status: | HPUB -- hold until publication | | Title: | Room temperature structure of Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2-oxoglutarate and Factor X derived peptide fragment, excess Fe removed | | Authors: | de Munnik, M., Rabe, P., Brewitz, L., Brasnett, A., Zhou, T., Schofield, C.J., Kern, J.F. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9hnz | | Status: | HPUB -- hold until publication | | Title: | Room temperature structure of Aspartyl/Asparaginyl beta-hydroxylase (AspH) in complex with Fe, 2-oxoglutarate and hydroxylated Factor X derived peptide fragment, 2 h O2 exposure | | Authors: | de Munnik, M., Rabe, P., Brasnett, A., Brewitz, L., Schofield, C.J. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9l04 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human ALK2 kinase domain with R206H mutation in complex with RK783 | | Authors: | Sakai, N., Mishima-Tsumagari, C., Shirouzu, M. | | Deposition date: | 2024-12-11 |
|
| PDBID: | 9hnj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of OrfM from ICESt3 of Streptococcus thermophilus | | Authors: | Tsan, P., Cappele, J., Laroussi, H., Clement, E., Favier, F., Didierjean, C., Soler, N., Leblond-Bourget, N. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9kzi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Candida albicans histone deacetylase HDA1 catalytic domain in complex with inhibitor JD1 | | Authors: | Chen, X., Ge, Y.H., Yang, H., Shi, Q., Li, C.C., Liu, N., Sheng, C.Q. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9mes | | Status: | HPUB -- hold until publication | | Title: | NMR strucuture of Dengue Virus 2 capsid protein with the deletion of the intrinsically disordered N-terminal region | | Authors: | Barbosa, G.M., Da Poian, A.T., Almeida, F.C.L. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9ky2 | | Status: | HPUB -- hold until publication | | Title: | Structure of beta-arrestin2 in complex with mouse C5aR1pp | | Authors: | Banerjee, R., Yadav, R., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Gati, C., Shukla, A.K. | | Deposition date: | 2024-12-07 |
|
