| PDBID: | 9p2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ProGH158 at 1.10 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ProGH158 at 1.42 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9vfw | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of pre-pore state II of heptameric alpha-hemolysin in the presence of RBCs | | Authors: | Chatterjee, A., Dutta, S., Roy, A. | | Deposition date: | 2025-06-11 | | Release date: | 2026-06-11 |
|
| PDBID: | 9vep | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Klebsiella pneumoniae SuhB | | Authors: | Jena, A.K., Yadav, V.K., Bhattacharyya, S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhz | | Status: | HPUB -- hold until publication | | Title: | Structure of a complex of biosynthetic proteins bE5 and CheytinYY | | Authors: | Li de la Sierra-Gallay, I., Gomes, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhr | | Status: | HPUB -- hold until publication | | Title: | FusA (ferredoxin receptor from Pectobacterium atrosepticum) in the presence of Ra-LPS | | Authors: | Machin, J.M., Ranson, N.A. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of sensory domain of CdgA from Vibrio cholerae O1 biovar El Tor str. N16961 | | Authors: | Marceau, A.H., Mariscal, V.T., Tripathi, S.M., Yildiz, F.H., Rubin, S.M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin | | Authors: | Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1t | | Status: | HPUB -- hold until publication | | Title: | A2AR-BRIL in complex with ZM241385 | | Authors: | Rao, P., Rathinaswamy, M., Chan, M., Paredes, A.G., Patel, C., Wranik, B.J., Powell, J., Eaton, D., Hicks, K.J., Mafi, A., Hao, Q. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9veq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Keap1 in complex with a small molecule inhibitor, KMN003 | | Authors: | Ishida, H., Osawa, M. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9vf5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of apo form of Arthrobacter psychrolactophillus L-arabinose isomerase | | Authors: | Laksmi, F.A., Nugraha, Y., Jayawardena, N., Raschdorf, O., Chek, M.F., Kohga, H., Herliana, L., Fathoni, A., Hidayat, I. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9rhq | | Status: | HOLD -- hold until a certain date | | Title: | Persulfide Dioxygenase from Acidithiobacillus caldus | | Authors: | Salgueiro, B.A., Ruhl, P., Archer, M., Kletzin, A., Frazao, C. | | Deposition date: | 2025-06-09 | | Release date: | 2026-06-09 |
|
| PDBID: | 9rhp | | Status: | HPUB -- hold until publication | | Title: | Self-complemented Archaeal bundling protein X (AbpX) | | Authors: | Sogues, A., Remaut, H., Sleutel, M. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1a | | Status: | HPUB -- hold until publication | | Title: | B. pseudomallei rubrerythrin room temperature structure from LEAP-X device | | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p19 | | Status: | HPUB -- hold until publication | | Title: | B. pseudomallei rubrerythrin room temperature structure | | Authors: | Saha, S., Budziszewski, G.R., Russi, S., Cohen, A., Bowman, S.E.J., Perry, S. | | Deposition date: | 2025-06-09 |
|
| PDBID: | 9p1b | | Status: | HPUB -- hold until publication | | Title: | P. putida mandelate racemase co-crystallized with tavaborole | | Authors: | Jabin, A., Hayden, J.A., Bearne, S.L., St.Maurice, M. | | Deposition date: | 2025-06-09 | | Sequence: | >Entity 1
MASWSHPQFEKGALEVLFQGPGYHMSEVLITGLRTRAVNVPLAYPVHTAVGTVGTAPLVLIDLATSAGVVGHSYLFAYTPVALKSLKQLLDDMAAMIVNEPLAPVSLEAMLAKRFCLAGYTGLIRMAAAGIDMAAWDALGKVHETPLVKLLGANARPVQAYDSHSLDGVKLATERAVTAAELGFRAVKTKIGYPALDQDLAVVRSIRQAVGDDFGIMVDYNQSLDVPAAIKRSQALQQEGVTWIEEPTLQHDYEGHQRIQSKLNVPVQMGENWLGPEEMFKALSIGACRLAMPDAMKIGGVTGWIRASALAQQFGIPMSSHLFQEISAHLLAATPTAHWLERLDLAGSVIEPTLTFEGGNAVIPDLPGVGIIWREKEIGKYLV
|
|
| PDBID: | 9p0o | | Status: | HPUB -- hold until publication | | Title: | MscS in Glyco-DIBMA Native Nanodiscs (C1 symmetry) | | Authors: | Moller, E., Britt, M., Zhou, F., Yang, H., Anishkin, A., Ernst, R., Juan, V.M., Sukharev, S., Matthies, D. | | Deposition date: | 2025-06-07 |
|
| PDBID: | 9rgh | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein is treated overnight with [VIVO(acac)2] | | Authors: | Tito, G., Ferraro, G., Merlino, A. | | Deposition date: | 2025-06-06 |
|
| PDBID: | 9rgf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS41783 from ECBL | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-06 |
|
| PDBID: | 9rga | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS87208 from ECBL | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-06 |
|
| PDBID: | 9rgj | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein is treated 24 h with [VIVO(acac)2] | | Authors: | Tito, G., Ferraro, G., Merlino, A. | | Deposition date: | 2025-06-06 |
|
| PDBID: | 9rgi | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein is treated 6 days with [VIVO(acac)2] | | Authors: | Tito, G., Ferraro, G., Merlino, A. | | Deposition date: | 2025-06-06 |
|
| PDBID: | 9rgg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zika NS2B-NS3 protease in complex with follow-up compound EOS90861 from ECBL | | Authors: | Benz, L.S., Wollenhaupt, J., Jirgensons, A., Miletic, T., Mueller, U., Weiss, M.S. | | Deposition date: | 2025-06-06 |
|
| PDBID: | 9p0d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Sr2+-bound RTX domain block V of adenylate cyclase toxin from Bordetella pertussis | | Authors: | Gudinas, A.P., Fernandez, D., Mai, D.J. | | Deposition date: | 2025-06-06 |
|
| PDBID: | 9p0c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ca2+-bound RTX domain block V of adenylate cyclase toxin from Bordetella pertussis | | Authors: | Gudinas, A.P., Chang, M.P., Fernandez, D., Mai, D.J. | | Deposition date: | 2025-06-06 |
|
