Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9wxj
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxa
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxb
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of reduced form of formatedehydrogenase from Rhodobacter aestuarii (RaFDH) with NADH
Authors:Zhang, K., Zhang, L.
Deposition date:2025-09-25
Release date:2026-03-25
PDBID:9wxg
Status:HPUB -- hold until publication
Title:Single Chain Protein of De Novo Designed Helix Bundles-4DH1 with KDPV Loop
Authors:Du, G.M., Zhang, S.-Q., Liu, L.J.
Deposition date:2025-09-25
PDBID:9wxc
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxf
Status:AUTH -- processed, waiting for author review and approval
Title:cryo-electron microscopy structure of Dandelion
Authors:Yu, Y., Chen, Q., Tang, Y.
Deposition date:2025-09-25
PDBID:9wxk
Status:AUTH -- processed, waiting for author review and approval
Title:Linear fragment of lycosin9I with anti-MRSA activity
Authors:Mironov, P.A., Dubovskii, P.V., Shenkarev, Z.O.
Deposition date:2025-09-25
PDBID:9wx9
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxn
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxl
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxd
Status:HPUB -- hold until publication
Title:Cryo-EM structure of of BetTC cage
Authors:Shi, D.J., Cheng, X.Q., Jiang, W.X., Xing, Q.
Deposition date:2025-09-25
PDBID:9wxp
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxq
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9wxo
Status:AUTH -- processed, waiting for author review and approval
Title:MSL3 bound to the H3K36me3 nucleosome
Authors:Tang, F.Y., Zhou, Z.
Deposition date:2025-09-25
PDBID:9wxr
Status:AUTH -- processed, waiting for author review and approval
Title:sensory rhodopsin I with its cognate transducer HtrI
Authors:Lim, G.Z., Lin, Y.E., Wu, Y.M., Chen, P.C., Fu, H.Y., Yang, C.S.
Deposition date:2025-09-25
PDBID:9wxs
Status:HPUB -- hold until publication
Title:Silver-bound E.coli Malate dehydrogenase (C251S)
Authors:Wang, H., Wang, M., Sun, H.
Deposition date:2025-09-25
Sequence:

>Entity 1


MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVESAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIALGEEFVNK
PDBID:9wxe
Status:HOLD -- hold until a certain date
Title:X-ray Crystal Structure of Pseudoazurin Met16Ala variant
Authors:Sugai, A., Yamaguchi, T.
Deposition date:2025-09-25
Release date:2026-09-25
Sequence:

>Entity 1


ADFEVHMLNKGKDGAAVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
PDBID:9wxt
Status:PROC -- to be processed
Title:Cryo-EM structure of Fks1 in open state
Authors:You, Z.L., Bai, L.
Deposition date:2025-09-25
PDBID:9yf8
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9yf4
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9yf9
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9yf5
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2025-09-25
PDBID:9yfe
Status:REPL -- author sent new coordinates, entry to be reprocessed
Deposition date:2025-09-25
PDBID:9yff
Status:PROC -- to be processed
Deposition date:2025-09-25
PDBID:9yf3
Status:AUTH -- processed, waiting for author review and approval
Title:ELIC5 in spNW15 nanodiscs with 2:1:1 POPC:POPE:POPG
Authors:Tan, B.K., Cheng, W.W.L.
Deposition date:2025-09-25

243531

数据于2025-10-22公开中

PDB statisticsPDBj update infoContact PDBjnumon