| PDBID: | 9hef | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heo | | Status: | HPUB -- hold until publication | | Title: | Open-state RyR1 in 0.05% POPC micelles, in complex with a nanobody and FKBP | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heq | | Status: | HPUB -- hold until publication | | Title: | Open-state RyR1 in 0.01% POPC micelles, in complex with a nanobody and FKBP12 | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hes | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hei | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hem | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9heh | | Status: | HPUB -- hold until publication | | Title: | Structure of the ligand binding domain of the chemoreceptor MkcA (DSOMK10_RS0100305) of Dickeya solani MK10 in complex with choline | | Authors: | Gavira, J.A., Rico-Jimenez, M., Matilla, M.A. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9hen | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kla | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the bromodomain of human BRD9 in complex with the inhibitor Y22024 | | Authors: | Chen, Z., Zhang, C., Xu, H., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkv | | Status: | HOLD -- hold until a certain date | | Title: | Structure-guided interface engineering for modifying substrate binding and catalytic activity of 2-keto-3-deoxy-D-xylonate dehydratase | | Authors: | Liang, B. | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 |
|
| PDBID: | 9kl9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kks | | Status: | HOLD -- hold until a certain date | | Title: | Solution NMR structure of Pseudoazurin | | Authors: | Yamaguchi, T., Obara, Y., Fujikawa, K., Yamasaki, K., Kohzuma, T. | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 | | Sequence: | >Entity 1
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
|
|
| PDBID: | 9kl3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pleurocybella porrigens lectin (PPL) in complex with GalNAc | | Authors: | Adachi, D., Ishimoto, N., Kawabata, H., Mizutani, K., Park, S.-Y., Tame, J.R.H., Kamata, K. | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kl4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9klm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-14 |
|
| PDBID: | 9kkt | | Status: | HOLD -- hold until a certain date | | Title: | Structure-guided interface engineering for modifying substrate binding and catalytic activity of 2-keto-3-deoxy-D-xylonate dehydratase | | Authors: | Liang, B. | | Deposition date: | 2024-11-14 | | Release date: | 2025-11-14 |
|
