| PDBID: | 8v79 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 15 | | Authors: | Wang, H., Shears, S.B. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xae | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xad | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xaf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2 | | Authors: | Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xah | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xaa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-03 |
|
| PDBID: | 8xac | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of amidase from Pseudonocardia acaciae | | Authors: | Takenoya, M., Yajima, S. | | Deposition date: | 2023-12-03 |
|
| PDBID: | 8xa7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8xa8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8xa6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8xa5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8rah | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ray | | Status: | HPUB -- hold until publication | | Title: | ParA in complex with ATP | | Authors: | Mais, C.-N., Bange, G. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rau | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rav | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rax | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rar | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
