| PDBID: | 9gi5 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)-2-oxoglutarate-dependent Oryza sativa dioxygenase HSL1 in complex with 2-oxoglutarate | | Authors: | Dhingra, S., Alshref, F.M., Farcas, I., Allen, M.D., Brewitz, L., Schofield, C.J. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9j5l | | Status: | HPUB -- hold until publication | | Title: | Complex structure of influenza hemagglutinin HA stem with CR9114 Fab and FISW84 Fab | | Authors: | Ru, Y.X., Liu, D.J., Deng, L., Li, Y.W. | | Deposition date: | 2024-08-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9gfr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anti-collagen type II antibody Fab (PC12) complexed with collagen triple helical peptide (THP59) | | Authors: | Ge, C., Dobritzsch, D., Holmdahl, R. | | Deposition date: | 2024-08-12 |
|
| PDBID: | 9d0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Se-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.45A resolution | | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9d0g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with O-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9d0h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with C-cresomycin, mRNA, deacylated A-site tRNAphe, aminoacylated P-site fMet-tRNAmet, and deacylated E-site tRNAphe at 2.50A resolution | | Authors: | Aleksandrova, E.V., Wu, K.J.Y., Robinson, P.J., Benedetto, A.E., Yu, M., Tresco, B.I.C., See, D.N.Y., Jiang, T., Ramkissoon, A., Dunand, C.F., Svetlov, M.S., Lee, J., Myers, A.G., Polikanov, Y.S. | | Deposition date: | 2024-08-07 |
|
| PDBID: | 9j24 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism | | Authors: | Lu, D., Ma, H.L. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9j25 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism | | Authors: | Lu, D., Ma, H.L. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9j1u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structural basis of the bifunctionality of M. salinexigens ZYF650T glucosylglycerol phosphorylase in glucosylglycerol catabolism | | Authors: | Lu, D., Ma, H.L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9cze | | Status: | HPUB -- hold until publication | | Title: | High-Resolution Structure of Human DHODH for Molecular Replacement in Fragment Screening Campaign | | Authors: | Purificacao, A.D., Benz, L.S., Froes, T.Q., Weiss, M.S., Nonato, M.C. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM24 PHD-BRD in complex with N-(2-(2-(2-acetamidoethoxy)ethoxy)ethyl)-3-(N-(1,3-dimethyl-2-oxo-6-(3-propoxyphenoxy)-2,3-dihydro-1H-benzo[d]imidazol-5-yl)sulfamoyl)benzamide (PEG linker unresolved) | | Authors: | Platt, M.A., Kot, E., Conway, S.J., Koekemoer, L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j0e | | Status: | HPUB -- hold until publication | | Title: | Catalyst-free photoinitiated intramolecular carbon-carbon coupling enables the efficient synthesis of pharmaceutically important biaryls | | Authors: | Yang, L., Qu, X.D. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcr | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-1-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9gcq | | Status: | HPUB -- hold until publication | | Title: | Human Butyrylcholinesterase in complex with N1,N1-dimethyl-N2-(6-(naphthalen-2-yl)-5-(pyridin-4-yl)pyridazin-3-yl)ethane-1,2-diamine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 9cya | | Status: | HPUB -- hold until publication | | Title: | C387S variant of D-ornithine/D-lysine decarboxylase complexed with HEPES and putrescine | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYPTPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFAS(LLP)TCSVMGVLKAIRDAGICAEANSQYEVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKVANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQVPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAGITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVECHVEWKFVDAGYSVLSDSQHFDWFFYVYNASRMTAAHDAWIKLAGPLSDGGDYFHMGVKGEEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGDTRLIRREDSYEDMVKYDIYLLAAALEHHHHHH
|
|
| PDBID: | 9gc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gbi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI wild-type | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an amyloid fibril formed by SOD1 mutant - G93A | | Authors: | Zhang, M.Y., Ma, Y.Y., Wang, L.Q., Xia, W.C., Yuan, H.Y., Zhao, K., Chen, J., Li, D., Zou, L.Y., Wang, Z.Z., Liu, C., Liang, Y. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9iyj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an amyloid fibril formed by SOD1 mutant - D101N | | Authors: | Zhang, M.Y., Ma, Y.Y., Wang, L.Q., Xia, W.C., Yuan, H.Y., Zhao, K., Chen, J., Li, D., Zou, L.Y., Wang, Z.Z., Liu, C., Liang, Y. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9gbd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 in complex with the cyclic peptide 5C6 | | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | | Deposition date: | 2024-07-30 |
|
| PDBID: | 9gah | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Complement Factor H central CCP domains 8-14 | | Authors: | Monecke, T., Schmidt, C.Q., Niessing, D. | | Deposition date: | 2024-07-29 |
|
| PDBID: | 9iv5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BRD4 in complex with compound7 | | Authors: | Du, Z., Chen, X., Cao, D., Jiang, Z., Xiong, B. | | Deposition date: | 2024-07-23 |
|
| PDBID: | 9cpz | | Status: | HPUB -- hold until publication | | Title: | C387S variant of D-ornithine/D-lysine decarboxylase complexed with PMP and 4-guanidinobutanal | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2024-07-18 | | Sequence: | >Entity 1
MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYPTPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFASKTCSVMGVLKAIRDAGICAEANSQYEVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKVANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQVPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAGITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVECHVEWKFVDAGYSVLSDSQHFDWFFYVYNASRMTAAHDAWIKLAGPLSDGGDYFHMGVKGEEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGDTRLIRREDSYEDMVKYDIYLLAAALEHHHHHH
|
|
| PDBID: | 9cpa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the Mammalian DHX29-bound 43S Pre-initiation Complex | | Authors: | Cui, D., des Georges, A. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 9g6a | | Status: | HPUB -- hold until publication | | Title: | Peptide-Small Molecule Hybrids as Novel Selective Irreversible Cathepsin-K Inhibitors in Primary Osteoclasts and Human Lung Cancer Tissue | | Authors: | Turk, D., Loboda, J. | | Deposition date: | 2024-07-18 |
|
