| PDBID: | 8xtq | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 2 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xtp | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 4 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8xts | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Shang, S.T., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8vk6 | | Status: | HPUB -- hold until publication | | Title: | Amide-linked, extended 14alpha-demethylase (CYP51) with antifungal azole inhibitor | | Authors: | Tyndall, J.D.A., Monk, B.C., Simons, C. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xrq | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | | Authors: | Liu, C.C., Ju, B., Zhang, Z. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8xro | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-01-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8rmh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of parallel G-quadruplex containing T-tetrads and TG-octaplet | | Authors: | Abdullrahman, A., El Omari, K., Paterson, N., Orr, C., Lambert, M., Cardin, C.J., Sanchez-Weatherby, J., Hall, J.P. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8vj9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant with the C edge loop from Arrestin2 inserted | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-22 |
|
| PDBID: | 8vji | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of capsid of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8vja | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of tail of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8vjh | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of tail-tip of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8viv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FBF-2 RBD in complex with gld-1 FBEa* RNA | | Authors: | Qiu, C., Hall, T.M.T. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viy | | Status: | HPUB -- hold until publication | | Title: | 15-Lipoxygenase-2 V427L | | Authors: | Gilbert, N.C., Offenbacher, A.R., Ohler, A.R.L. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rl6 | | Status: | HPUB -- hold until publication | | Title: | DNA helicase RECQL5 in complex with homo Di-Gluebody G5-006 - RECQL5 local refinement | | Authors: | Yi, G., Ye, M., Mamalis, D., Sauer, D.B., von Delft, F., Davis, B.G., Gilbert, R.J.C. | | Deposition date: | 2024-01-02 |
|
| PDBID: | 8vhx | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of neck of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-02 | | Release date: | 2025-01-02 |
|
| PDBID: | 8xoq | | Status: | HPUB -- hold until publication | | Title: | Human Calcium and Integrin Binding Protein 2 (CIB2) Bound to TMC1 CBD-1 domain at 2.4 Angstroms resolution | | Authors: | Li, Y.H., Chen, J.S., Zhang, X., Wang, C. | | Deposition date: | 2024-01-02 |
|
| PDBID: | 8xna | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of serine hydroxymethyltransferase 2 | | Authors: | Fan, S., Lv, R., Wang, C., Tang, M., Wei, X., Jin, Y., Yang, Z. | | Deposition date: | 2023-12-29 | | Release date: | 2024-12-29 |
|
| PDBID: | 8xnd | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of serine hydroxymethyltransferase 1 | | Authors: | Fan, S., Wei, X., Lv, R., Wang, C., Tang, M., Jin, Y., Yang, Z. | | Deposition date: | 2023-12-29 | | Release date: | 2024-12-29 |
|
| PDBID: | 8rkp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytochrome c prime from Hydrogenophilus thermoluteolus: Ferrous recombinant native with bound NO | | Authors: | Fujii, S., Hough, M.A. | | Deposition date: | 2023-12-27 | | Release date: | 2024-12-27 |
|
| PDBID: | 8xkq | | Status: | HOLD -- hold until a certain date | | Title: | Structure of guanosine-2''''-fluorinated [d(AACCGGTT)]2 | | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | | Deposition date: | 2023-12-24 | | Release date: | 2024-12-24 |
|
| PDBID: | 8xjd | | Status: | HPUB -- hold until publication | | Title: | Structure of R&R Chitin-binding domain bound to Chitin. | | Authors: | Hu, S.F., Li, J., Shi, C.W. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rjh | | Status: | HPUB -- hold until publication | | Title: | HLA A*2402-NF9_6F pMHC complex | | Authors: | Wall, A., Sewell, A.K., Motozono, C., Rizkallah, P.J., Fuller, A. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rji | | Status: | HPUB -- hold until publication | | Title: | HLA A*2402-NF9_5R pMHC complex | | Authors: | Wall, A., Motozono, C., Sewell, A.K., Rizkallah, P.J., Fuller, A. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8rj5 | | Status: | HOLD -- hold until a certain date | | Title: | P1-15 T-cell Receptor bound to HLA A*2402-NF9 pMHC complex | | Authors: | Wall, A., Sewell, A.K., Motozono, C., Rizkallah, P.J., Fuller, A. | | Deposition date: | 2023-12-20 | | Release date: | 2024-12-20 |
|
