| PDBID: | 9m7k | | Status: | HPUB -- hold until publication | | Title: | Heptamer Msp1 from S.cerevisiae (with a catalytic dead mutation) in complex with an unknown peptide substrate | | Authors: | Chengdong, H., Simin, W., Xuan, C. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9nol | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MBP-TREM2 N79Q Ig domain fusion | | Authors: | Brett, T.J., Greven, J.A. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9noj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [2,6,11-2] Shifted DNA assembly with an aspect ratio of (2,6,11) base pairs and 2 nt sticky ends | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9nog | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [0,6,13-2] Shifted DNA assembly with an aspect ratio of (0,6,13) base pairs and 2 nt sticky ends containing a semi-junction | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9nok | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [0,6,13-2] Shifted DNA assembly with an aspect ratio of (0,6,13) base pairs and 2 nt sticky ends containing a semi-junction | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9non | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of amyloid fibril isolated from the kidney of a variant Alect2-I40V amyloidosis patient | | Authors: | Nguyen, B., Saelices, L. | | Deposition date: | 2025-03-10 | | Release date: | 2026-03-10 |
|
| PDBID: | 9np0 | | Status: | HPUB -- hold until publication | | Title: | Structure of human annexin A1 in complex with 2C1 Fab | | Authors: | Nadezhdin, K.D., Sobolevsky, A.I. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9nof | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [7,7,6-1] Shifted tensegrity triangle with an (arm,center,arm) distribution of (7,7,6) base pairs and 1 nt sticky ends, with hexagonal symmetry | | Authors: | Abi Rizk, J., Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9qen | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human O-GlcNAcase | | Authors: | Basse Hansen, S., Bartual, S.G., Yuan, H., Raimi, O.G., Gorelik, A., Ferenbach, A.T., Lytje, K., Pedersen, J.S., Drace, T., Boesen, T., van Aalten, D.M.F. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9qep | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of O-GlcNAcase from Trichoplax Adhaerens | | Authors: | Basse Hansen, S., Bartual, S.G., Yuan, H., Raimi, O.G., Gorelik, A., Ferenbach, A.T., Lytje, K., Pedersen, J.S., Drace, T., Boesen, T., van Aalten, D.M.F. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9qei | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01866774 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9nod | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [4,3,12-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (4,3,12) base pairs and 2 nt sticky ends | | Authors: | Horvath, A., Woloszyn, K., Vecchioni, S., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-03-09 |
|
| PDBID: | 9noa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of unliganded Fab MS-1805 | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9nob | | Status: | HPUB -- hold until publication | | Title: | Crystal Structutre of unliganded Fab 224 | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9no8 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of computationally designed bundlemer peptide nanotube (14 protofilament) | | Authors: | Das, A., Conticello, V.P. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9no9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of computationally designed bundlemer peptide nanotube (15 protofilament) | | Authors: | Das, A., Conticello, V.P. | | Deposition date: | 2025-03-08 |
|
| PDBID: | 9m6f | | Status: | HPUB -- hold until publication | | Title: | A thermostable zearalenone degrading enzyme mutant - S102A | | Authors: | Ouyang, B., Xu, W. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m6h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | structure of FliD-FliC at a 10:10 stoichiometry | | Authors: | Xing, Q., Cheng, X.Q., Jiang, W.X. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m6j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S. aureus protein A bound to a camelid single-domain antibody | | Authors: | Kong, Y., Shi, J.L., Wu, F.D., Zhao, T., Zhu, X.Y., Xu, Q.Y., Wang, R.B., Song, Y.D., Li, Q.X., Wang, Y.L., Gao, X.Y., Yang, Y.D., Wu, Y.L., Yang, Z.L., Yao, J.H., Ying, T.L. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S. aureus protein A bound to a camelid single-domain antibody | | Authors: | Kong, Y., Shi, J.L., Wu, F.D., Zhao, T., Zhu, X.Y., Xu, Q.Y., Wang, R.B., Song, Y.D., Li, Q.X., Wang, Y.L., Gao, X.Y., Yang, Y.D., Wu, Y.L., Yang, Z.L., Yao, J.H., Ying, T.L. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m64 | | Status: | HPUB -- hold until publication | | Title: | Structure of SPIN90 dimer-Arp2/3 complexes-nucleated actin filaments (Doublet Complex) | | Authors: | Francis, J., Pathri, A.K., Chowdhury, S. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9qdv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the polyester hydrolase Leipzig 7 (PHL7) mut3 variant expressed in E. coli (E_PHL7mut3) | | Authors: | Useini, A., Strater, N., Striedner, G., Sonnendecker, C. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9qea | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF LYSYL-TRNA SYNTHETASE FROM Mycobacterium tuberculosis COMPLEXED WITH L-LYSINE AND INHIBITOR DDD01839469 | | Authors: | Dawson, A., Cleghorn, L.A.T., Davis, S.H. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9nnv | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of CCoV-HuPn-2018 main protease bound to non-covalent inhibitor X77 at 2.15A | | Authors: | Jayashankar, U., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVSENATLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGVNLQ
|
|
| PDBID: | 9nnw | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-050-23 at 1.55 A | | Authors: | Beechboard, S.N., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
