| PDBID: | 9swn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NcBBE14 | | Authors: | Bijelic, A., Baldauf, S., Macheroux, P. | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9sww | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9sws | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9swy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-07 |
|
| PDBID: | 9x2l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9x2m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9x2n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | JP Complex - E. coli MurJ, Levivirus PP7 lysis protein SglPP7 | | Authors: | Kohga, H., Hosoda, K., Tsukazaki, T. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yka | | Status: | AUCO -- author corrections pending review | | Title: | Cryo-EM structure of post-fusion EBV gB in complex with AMMO2 fab | | Authors: | Chou, C.W., McCool, R.S., McLellan, J.S. | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9ykc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yjz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk1 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk3 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of D132N Bacillus halodurans RNase H1 in complex with complementary RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
CGACAU
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk4 | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-06 |
|
| PDBID: | 9yk5 | | Status: | HPUB -- hold until publication | | Title: | 100K X-ray structure of mixed metal D132N Bacillus halodurans RNase H1 complex with RNA/DNA duplex | | Authors: | Kovalevsky, A., Gerlits, O. | | Deposition date: | 2025-10-06 | | Sequence: | >Entity 1
SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
>Entity 2
UCGACA
>Entity 3
(DA)(DT)(DG)(DT)(DC)(DG)
|
|
| PDBID: | 9yk7 | | Status: | PROC -- to be processed | | Deposition date: | 2025-10-06 |
|
