| PDBID: | 9qm5 | | Status: | HPUB -- hold until publication | | Title: | Krypton-pressurized Methyl-Coenzyme M reductase of an ANME-2c isolated from a microbial enrichment | | Authors: | Mueller, M.-C., Wagner, T. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvb | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of human SMYD1 in complex with MYH2 peptide and SAH | | Authors: | Zeng, H., Dong, A., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvd | | Status: | HPUB -- hold until publication | | Title: | NSF Mg2+ class 2 hexamer | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvg | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 BA.1 spike RBD bound to COV2-3835 Fab | | Authors: | Ramamohan, A.R., Johnson, N.V., McLellan, J.S. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nuz | | Status: | HPUB -- hold until publication | | Title: | Y20S after Mg2+ (Sec18) - Class 4 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv1 | | Status: | HPUB -- hold until publication | | Title: | Sec18 Mg2+ class 1 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv0 | | Status: | HPUB -- hold until publication | | Title: | Sec18 Mg2+ class 2 | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nv9 | | Status: | HPUB -- hold until publication | | Title: | NSF Mg2+ class 1 heptamer | | Authors: | Khan, Y.A., Brunger, A.T. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9nvm | | Status: | HPUB -- hold until publication | | Title: | ATPase Hybrid F1 with the ancestral core domains Catalytic Dwell | | Authors: | Stewart, A.G., Noji, H., Sobti, M., Suzuki, A.K. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qky | | Status: | HPUB -- hold until publication | | Title: | The structure of the DNA-binding domain of Nuclear Factor 1 X bound to NFI consensus DNA sequence | | Authors: | Tiberi, M., Nardini, M., Chaves-Sanjuan, A., Gourlay, L.J., Bonnet, D.M.V. | | Deposition date: | 2025-03-20 |
|
| PDBID: | 9qld | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-nitrophenol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-03-20 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9u42 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Homogentisate 1,2-Dioxygenase from Acinetobacter in Complex with Zn ion | | Authors: | Seo, P.-W., Hwangbo, S.-A., Park, S.-Y. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nui | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1b from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1c from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 2a from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nul | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 2b from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9num | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 3 from merged particles | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nun | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1a from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1b from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nup | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1c from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nuq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 2a from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nur | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 2b from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nus | | Status: | HPUB -- hold until publication | | Title: | SsoPfMCM:DNA class 3 from DNA 1 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nut | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 1a from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
| PDBID: | 9nux | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SsoPfMCM:DNA class 2b from DNA 2 | | Authors: | Enemark, E.J., Rasouli, S., Myasnikov, A. | | Deposition date: | 2025-03-19 |
|
