| PDBID: | 9i3w | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-8C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i43 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-9D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3x | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-11B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3z | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-12D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i41 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-3C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i40 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-4D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i45 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-10B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
QSALTQPASVSGSPGQSITISCTGTSSIFGSYYLVSWYQQYPGKAPKLIVYEGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEAAYYCCSYAGTRTYVFGTGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADKSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
>Entity 2
EVQLVQSGSELKKPGASVKVSCKVSRSTFVNYAVNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLLISGLKADDSAVYYCAYDPLGNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKHHHHHH
|
|
| PDBID: | 9i4c | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-1-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4d | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-2B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4b | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4e | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 34-1-6D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lol | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human MON1A-CCZ1-RAB7A | | Authors: | Li, X., Li, D., Tang, D., Wang, J., Qi, S. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9lok | | Status: | HPUB -- hold until publication | | Title: | The co-crystal structure of PTP1B complex with allosteric inhibitor Fumosorinone | | Authors: | Zhang, J., Lin, L., Yuchi, Z., Luo, D. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9n04 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GCGR-Gs complex with peptide 15 | | Authors: | Zhang, X., Jiang, Y., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9n05 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GLP-1R-Gs complex with SRB103Q | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M., Piper, S. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9i3l | | Status: | HPUB -- hold until publication | | Title: | Structure of E.coli ribosome with filamin mutant Y719E nascent chain at linker length of 47 amino acids, with tRNA | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2025-01-23 |
|
| PDBID: | 9mzg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GCGR-Gs complex with glucagon | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M., Jiang, Y. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mzf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of GLP-1R-Gs complex with peptide 15 | | Authors: | Zhang, X., Belousoff, J.M., Wootten, D., Sexton, M.P. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mze | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GLP-1R-Gs complex with oxyntomodulin | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9i3f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the AGR2 and IRE1beta_loop complex | | Authors: | Yan, Y., Ron, D. | | Deposition date: | 2025-01-22 |
|
| PDBID: | 9mxo | | Status: | HPUB -- hold until publication | | Title: | Motif2-Motif1 Left-handed parallel G-quadruplex in H3 Spacegroup | | Authors: | Hendrickson, A.D., Xing, E.R., Yatsunyk, L.A. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxu | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GLP-1R-Gs complex with glucagon | | Authors: | Zhang, X., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9ln7 | | Status: | HPUB -- hold until publication | | Title: | Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state. | | Authors: | Chen, H., Sun, D., Tian, C. | | Deposition date: | 2025-01-20 |
|
| PDBID: | 9mxd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human E104A calmodulin:MLCK RM20 complex | | Authors: | Brunzelle, J.S., Shuvalova, L., Watterson, D.M. | | Deposition date: | 2025-01-19 |
|
| PDBID: | 9lmm | | Status: | HPUB -- hold until publication | | Title: | An antibiotic biosynthesis monooxygenase family protein from Streptomyces sp. MA37 | | Authors: | Jiang, K., Qu, X.D. | | Deposition date: | 2025-01-19 |
|
