| PDBID: | 8qsa | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 86 (1084384) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qsh | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 23 (1083848). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qse | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 23 (1083848). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qsf | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 22 (1083853). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qsd | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 79 (1124379). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qsc | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 22 (1083853). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qsb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ternary structure of 14-3-3s, ARAF phosphopeptide (pS214) and compound 86 (1124384). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qsg | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, BRAF phosphopeptide (pS365) and compound 86 (1124384). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs2 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs3 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs4 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs6 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qri | | Status: | HPUB -- hold until publication | | Title: | TRRAP and EP400 in the human Tip60 complex | | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qr1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human Tip60 complex | | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., Schultz, P., Papai, G., Ben-Shem, A. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qql | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the human inward-rectifier potassium 2.1 channel (Kir2.1) - R312H mutant | | Authors: | Fernandes, C.A.H., Zuniga, D., Venien-Bryan, C. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8ug2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of de novo designed metal-controlled heterodimer of mutant B1 immunoglobulin-binding domain of Streptococcal Protein G MCHeT_A + MCHeT_C | | Authors: | Mealka, M., Maniaci, B., Stec, B., Huxford, T. | | Deposition date: | 2023-10-05 |
|
| PDBID: | 8qq9 | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 1-benzyl-3-(1-hydroxy-3,4-dihydro-1H-benzo[c][1,2]oxaborinin-7-yl)thiourea | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-04 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8qp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2023-09-30 | | Sequence: | >Entity 1
MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2
EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 8qp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E2 glycoprotein epitopeI 411-424 scaffold design 4CIL_04 | | Authors: | Nagarathinam, K., Cramer, J.T., Krey, T. | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8uds | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of CoxG from M. smegmatis, minus lipid anchoring C-terminus. | | Authors: | Rhys, R., Kropp, A. | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8wkz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Melanocortin-4 Receptor (MC4R) in complex with S31 | | Authors: | Gimenez, L.E., Martin, C., Yu, J., Hollanders, C., Hernandez, C., Dahir, N.S., Wu, Y., Yao, D., Han, G.W., Wu, L., Poorten, O.V., Lamouroux, A., Mannes, M., Tourwe, D., Zhao, S., Stevens, R.C., Cone, R.D., Ballet, S. | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8qog | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the yeast SPT-Orm2-Monomer complex | | Authors: | Schaefer, J., Koerner, C., Moeller, A., Froehlich, F. | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 8wke | | Status: | HPUB -- hold until publication | | Title: | Sulfate-bound SARS-CoV-2 Nsp9 | | Authors: | Chen, P.J., Huang, H.Y., Hsiao, W.C., Huang, C.Y. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 8wkf | | Status: | HPUB -- hold until publication | | Title: | Rational Design of Highly Selective PDE5 inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis | | Authors: | Zhang, F.C, Huang, Y.Y | | Deposition date: | 2023-09-27 |
|
| PDBID: | 8wkg | | Status: | HPUB -- hold until publication | | Title: | Rational Design of Highly Selective PDE5 inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis | | Authors: | Zhang, F.C., Huang, Y.Y. | | Deposition date: | 2023-09-27 |
|
