| PDBID: | 9i9c | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 29 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n6f | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease M165I covalently bound to inhibitor GRL-051-22 at 1.90 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D. | | Deposition date: | 2025-02-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHIELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n6a | | Status: | HPUB -- hold until publication | | Title: | GP23 C-termimal receptor binding domain from TM4 phage | | Authors: | Di, D., Rousseau, S., Krieger, I.V., Sacchettini, J.C. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lss | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of PDE5 with 1934 | | Authors: | Wu, D., Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5q | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease M49I covalently bound to inhibitor GRL-051-22 at 1.50 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-04 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDILNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n5r | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of CCoV-HuPn-2018 main protease covalently bound to inhibitor GRL-170-21 at 1.89A | | Authors: | Jayashankar, U., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-04 | | Sequence: | >Entity 1
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVSENATLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGVNLQ
|
|
| PDBID: | 9n5p | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN IGG2 FC FRAGMENT-FC-GAMMA RECEPTOR IIA COMPLEX H131 VARIANT | | Authors: | Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n54 | | Status: | HPUB -- hold until publication | | Title: | Bipartite p63 NLS in complex with Importin Alpha 2 | | Authors: | Esmaeili, S., Swarbrick, C.M.D., Forwood, J.K. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7y | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of KRasG13C in Complex with Nucleotide-based Covalent Inhibitor 7b | | Authors: | Niggenaber, J., Mueller, M.P., Rauh, D. | | Deposition date: | 2025-02-03 |
|
| PDBID: | 9i7u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of NDUFA4 bound complex IV within the respirasome complex | | Authors: | Nguyen, M.D., Singh, V., Rorbach, J. | | Deposition date: | 2025-02-02 |
|
| PDBID: | 9i79 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Xylose Isomerase collected at 20C using time-resolved serial synchrotron crystallography with Glucose at 180 seconds | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., TellKamp, F., Mehrabi, P. | | Deposition date: | 2025-01-31 |
|
| PDBID: | 9n2w | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dienelactone hydrolase family protein SaDLH from Solimonas aquatica | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2025-01-29 |
|
| PDBID: | 9lql | | Status: | HPUB -- hold until publication | | Title: | Structure of STG-hydrolyzing beta-glucosidase 1 (PSTG1) complexed with heptyl 1-thio-beta-D-glucopyranoside | | Authors: | Yanai, T., Arai, A., Takahashi, Y., Imaizumi, R., Takeshita, K., Matsuura, H., Sakai, N., Takahashi, S., Yamamoto, M., Kataoka, K., Nakayama, T., Yamashita, S. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9n2i | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GCGR-Gs complex with SRB103Q | | Authors: | Zhang, X., Mohebali, N., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9i5j | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 27 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-28 |
|
| PDBID: | 9n1v | | Status: | HPUB -- hold until publication | | Title: | High-resolution crystal structure of methyl-2,3-diamino propanoic acid-AMS inhibitor bound adenylation domain (A3) from Sulfazecin nonribosomal peptide synthetase SulM | | Authors: | Patel, K.D., Gulick, A.M. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9i56 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 23 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-27 |
|
| PDBID: | 9n1p | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GLP-1R-Gs complex with SRB103H | | Authors: | Zhang, X., Belousoff, M.J., Mohebali, N., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9n1q | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of GCGR-Gs complex with SRB103H | | Authors: | Zhang, X., Mohebali, N., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-26 |
|
| PDBID: | 9lp5 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human PTP1B | | Authors: | Zhang, J., Lin, L., Yuchi, Z., Luo, D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9lpe | | Status: | HPUB -- hold until publication | | Title: | ATPDF2 HDZIP domain complexed with DNA | | Authors: | Chen, W., Huang, H.D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GCGR-Gs complex with oxyntomodulin | | Authors: | Zhang, X., Jiang, Y., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3y | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 17 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the AGR2 dimer in complex with the monomeric IRE1beta luminal domain | | Authors: | Yan, Y., Hardwick, S., Tung, J., Ron, D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i42 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-2D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
