| PDBID: | 9qp3 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp5 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp6 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp7 | | Status: | PROC -- to be processed | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qpa | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qor | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qow | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoz | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nxw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Glutathione S-Transferase Bla g 22 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nxu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Glutathione S-Transferase Per a 22 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9nxt | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Glutathione S-Transferase Per a 21 | | Authors: | Zong, G., Pedersen, L.C., Mueller, G.A. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qnm | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2 | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qns | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnn | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Affitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Douat, C., Huc, I. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnq | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnw | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-25 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qny | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., KowaleWski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnx | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GP232 tail fiber recognition domain from mycobacteriophage Bxz-1 | | Authors: | Di, D., Tsai, J.H., Krieger, I.V., Sacchettini, J.C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of a P. Aeruginosa Gyrase Chimera In Complex with 20mer DNA and Ciprofloxacin | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9nx5 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a P. Aeruginosa Gyrase | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qn5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SUMO E1 with small unit cell parameters in the P1 21 1 space group. | | Authors: | Viloria, M., Francois, R.M.M., Didierjean, C. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmr | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qn6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-24 |
|
