PDBID: | 8rjp | Status: | HPUB -- hold until publication | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I2 intermediate state. | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | Deposition date: | 2023-12-21 |
|
PDBID: | 8rjq | Status: | HPUB -- hold until publication | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I3 intermediate state. | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | Deposition date: | 2023-12-21 |
|
PDBID: | 8rjr | Status: | HPUB -- hold until publication | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I4 intermediate state. | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | Deposition date: | 2023-12-21 |
|
PDBID: | 8rjs | Status: | HPUB -- hold until publication | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I5 intermediate state. | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | Deposition date: | 2023-12-21 |
|
PDBID: | 8rju | Status: | HPUB -- hold until publication | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I7 intermediate state. | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | Deposition date: | 2023-12-21 |
|
PDBID: | 8rjt | Status: | HPUB -- hold until publication | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I6 intermediate state. | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | Deposition date: | 2023-12-21 |
|
PDBID: | 8vb7 | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbh | Status: | AUTH -- processed, waiting for author review and approval | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vb9 | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbg | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbc | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbi | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbd | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbe | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8vbf | Status: | HPUB -- hold until publication | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | Deposition date: | 2023-12-12 |
|
PDBID: | 8rbg | Status: | HPUB -- hold until publication | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8r9v | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the primed actomyosin-5a complex | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-11-30 |
|
PDBID: | 8qza | Status: | HPUB -- hold until publication | Title: | D-2-hydroxyacid dehydrogenase (D2-HDH) from Haloferax mediterranei apo-enzyme (2.25 A resolution) | Authors: | Baker, P.J., Barrett, J.R., Dakhil, A.A.A.B., Domenech, J., Bisson, C., Pramanpol, N., Sedelnikova, S.E., Ferrer, J., Rice, D.W. | Deposition date: | 2023-10-26 |
|
PDBID: | 8qtw | Status: | HPUB -- hold until publication | Title: | Structure of human butyrylcholinesterase with (3-(((2-cycloheptylethyl)(methyl)amino)methyl)-1H-indol-7-yl)(methyl)carbamoylated Ser198 | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | Deposition date: | 2023-10-13 |
|
PDBID: | 8qtx | Status: | HPUB -- hold until publication | Title: | Structure of human butyrylcholinesterase with 3-(((2-cycloheptylethyl)(methyl)amino)methyl)-N-methyl-1H-indol-7-amine | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | Deposition date: | 2023-10-13 |
|
PDBID: | 8ugw | Status: | HPUB -- hold until publication | Title: | Computational design of highly signaling active membrane receptors through de novo solvent-mediated allosteric networks | Authors: | Wang, J., Chen, K.Y., Lai, J.K., Russell, A.M., Conners, K., Rutter, M.E., Condon, B., Tung, F., Kodandapani, L., Chau, B., Zhao, X., Benach, J., Baker, K., Hembre, E.J., Barth, P. | Deposition date: | 2023-10-06 |
|
PDBID: | 8qhf | Status: | HPUB -- hold until publication | Title: | Corynebacterium glutamicum mycoloyltransferase C acyl-enzyme intermediate | Authors: | Li de la Sierra-Gallay, I., Lesur, E. | Deposition date: | 2023-09-08 | Release date: | 2025-03-08 |
|
PDBID: | 8tn4 | Status: | HPUB -- hold until publication | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, used to study poly-N-acetyl-glucosamine broadly expressed in biofilm-forming pathogenclonal antibody | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | Deposition date: | 2023-08-01 | Sequence: | >Entity 1 EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>Entity 2 EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
PDBID: | 8tn7 | Status: | HPUB -- hold until publication | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, complexed with a disaccharide | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | Deposition date: | 2023-08-01 | Sequence: | >Entity 1 EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
>Entity 2 EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
|
|
PDBID: | 8tn5 | Status: | HPUB -- hold until publication | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, complexed with a GlcNH2 | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | Deposition date: | 2023-08-01 | Sequence: | >Entity 1 EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>Entity 2 EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|