| PDBID: | 9wgt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FGFR1 kinase domain in complex with LJ5350((2R,3R,4S,5R)-2-(4-amino-5-(7-methoxy-5-methylbenzo[b]thiophen-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-5-(aminomethyl)tetrahydrofuran-3,4-diol) | | Authors: | Moon, S.H., Ko, H.L., Han, B.W. | | Deposition date: | 2025-08-25 |
|
| PDBID: | 9wfk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FGFR1 kinase domain in complex with LJ5368((2R,3R,4S,5R)-2-(4-amino-5-(7-methoxy-5-methylbenzo[b]thiophen-2-yl)-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol) | | Authors: | Moon, S.H., Ko, H.L., Han, B.W. | | Deposition date: | 2025-08-21 |
|
| PDBID: | 9sbp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Yeast RNA polymerase II elongation complex with ATP frame-5 | | Authors: | Yi, G., Li, Q., Zhang, P., Wang, D. | | Deposition date: | 2025-08-08 |
|
| PDBID: | 9saj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP14 in complex with compound 5 | | Authors: | Georgiou, I., Robinson, C., OByrne, S., Matsuda, A., Grygier, P., Smith, C., ONeill, S., Ahmad, S., Post, J., Groenewold, G.J.M., Urakova, N., Wanningen, P., Kresik, L., Plewka, J., Delpal, A., See, K., Eadsforth, T., Paul, M., Lis, K., Decroly, E., Singh Saikatendu, K., Chang, E., Snijder, E.J., Czarna, A., Pyrc, K., Scott, D., Gilbert, I. | | Deposition date: | 2025-08-07 |
|
| PDBID: | 9w6o | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6, top NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w72 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w73 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 2) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w6t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w71 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9s7y | | Status: | HPUB -- hold until publication | | Title: | Structure of an activated, truncated human 60 kDa lysophospholipase mutant at 2.5 A resolution | | Authors: | Rabe von Pappenheim, F., Tittmann, K. | | Deposition date: | 2025-08-05 |
|
| PDBID: | 9w6e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer assembled with DNA truncated at SHL-4.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle trimer assembled with DNA truncated at SHL-4.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle tetramer assembled with DNA truncated at SHL-4.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 3) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 4) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6n | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5, bottom NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 6, bottom NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6j | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1, top NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle trimer assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6k | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 1&2, bottom NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6l | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 2, top NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9w6m | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a stacked human nucleosome core particle dimer (type 5, top NCP) assembled with DNA truncated at SHL-5.5 | | Authors: | Mu, Z., Huang, J. | | Deposition date: | 2025-08-04 |
|
| PDBID: | 9s64 | | Status: | HPUB -- hold until publication | | Title: | Human TEAD1 in complex with 2-(4-chloro-3-{3-methyl-5-[4-(trifluoromethyl)phenoxy]phenyl}-1H-pyrrolo[3,2-c]pyridin-1-yl)ethan-1-ol | | Authors: | Musil, D., Freire, F. | | Deposition date: | 2025-07-30 |
|
| PDBID: | 9s5p | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 0.5 s | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
| PDBID: | 9s5r | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 5 s | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
