| PDBID: | 8s6n | | Status: | HPUB -- hold until publication | | Title: | Structure of MLLE3 in complex with PAMPL1 | | Authors: | Devan, S., Shanmugasundaram, S., Muentjes, K., Smits, S.H., Altegoer, F., Feldbruegge, M. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8s6o | | Status: | HPUB -- hold until publication | | Title: | Structure of MLLE3 in complex with PAMPL2 | | Authors: | Devan, S., Shanmugasundaram, S., Muentjes, K., Smits, S.H., Altegoer, F., Feldbruegge, M. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8yh4 | | Status: | HPUB -- hold until publication | | Title: | Chito oligosaccharide deacetylase from vibrio campbellii (VhCOD) in complex with chitosanbiose (GlcN)2 | | Authors: | Sirikan, P., Tamo, F., Robinson, R.C., Wipa, S. | | Deposition date: | 2024-02-27 |
|
| PDBID: | 8yfp | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Chito oligosaccharide deacetylase from vibrio campbellii (VhCOD) | | Authors: | Sirikan, P., Tamo, F., Robinson, R.C., Wipa, S. | | Deposition date: | 2024-02-25 |
|
| PDBID: | 8s1y | | Status: | HPUB -- hold until publication | | Title: | ThaOS V79A | | Authors: | Basle, A., Ashley, B., Campopiano, D.J., Marles-wright, J. | | Deposition date: | 2024-02-16 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vwf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Anisomycin-induced collided mammalian ribosomes | | Authors: | Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8y55 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of NAMPT-PF403 | | Authors: | Yu, S.S., Liu, Y.B., Li, Y. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8vvu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Anisomycin-bound mammalian ribosome with partially accommodated A-site tRNA | | Authors: | Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8vvp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Codon sampling state obtained from Anisomycin-treated mammalian ribosomes | | Authors: | Loerch, S., Petrossian, E., Smith, P.R., Campbell, Z.T. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8vrl | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium smegmatis 50S ribosomal subunit bound to HflX and chloramphenicol:50S-HflX-A-Clm | | Authors: | Majumdar, S., Koripella, R.K., Sharma, M.R., Manjari, S.R., Banavali, N.K., Agrawal, R.K. | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8rqw | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase (T188E) AMP-PNP complex | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8rqx | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase R65S+T188D - AMP-PNP complex | | Authors: | livnah, O., Gutman, D. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8xy8 | | Status: | HPUB -- hold until publication | | Title: | a beta-lactamase - AmpC | | Authors: | Ma, W.Z., Song, W. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8rqv | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase (T188A) AMP-PNP complex | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8vqf | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of natural Can f 1 in complex with human IgE 1J11 Fab | | Authors: | Khatri, K., Ball, A., Richardson, C.M., Smith, S.A., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8vqg | | Status: | HPUB -- hold until publication | | Title: | X-ray crystal structure of Can f 1 | | Authors: | Khatri, K., Geoffrey, M.A., Pedersen, L.C., Champan, M.D., Pomes, A., Chruszcz, M. | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8xhn | | Status: | HOLD -- hold until a certain date | | Title: | Streptococcus pneumoniae-BceAB-ADP-Peptidisc Sample. | | Authors: | He, Y., Li, J., Luo, M. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8xex | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with AMP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8vb3 | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase from Solimonas fluminis | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xdj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AMPylated HEPN toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8v4w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Campylobacter concisus Csep1 | | Authors: | Anna, R., Xiaotian, Z. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8v18 | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v19 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | RNA polymerase II elongation complex with Syn conformation 8-oxoguanine with AMP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x5s | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of shikimate kinase of Mycobacterium tuberculosis complex with shikimate-3-phosphate | | Authors: | Yadav, A.K., Madhuri, M., Saini, C., Inampudi, K.K., Ethayathulla, A.S., Kumar, M. | | Deposition date: | 2023-11-18 | | Release date: | 2024-11-18 |
|
