| PDBID: | 9ndx | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) refinement of aptamer and core | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndv | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ncr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and symmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional G/C rich expansion sequence | | Authors: | Shields, E.T., Snow, C.D., Slaughter, C.K. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lwt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PL25 ulvan lyase TsUly25A | | Authors: | Han, F., Wang, D., Wang, W. | | Deposition date: | 2025-02-16 |
|
| PDBID: | 9ic7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of alpha-synuclein fibrils formed in artificial cerebrospinal fluid (aCSF) | | Authors: | Snieckute, R., Sulskis, D., Jocyte, A., Venclovaite, U., Tamulyte, R., Ziaunys, M., Smirnovas, V., Sakalauskas, A. | | Deposition date: | 2025-02-14 |
|
| PDBID: | 9ibs | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM Structure of Self-assembled Zymomonas mobilis Levansucrase Nanotube | | Authors: | Yu, Y., Sonani, R.R., Hadad, N., Salama, R., Shoham, G., Egelman, E., Shoham, Y., Danino, D. | | Deposition date: | 2025-02-13 | | Release date: | 2026-02-13 |
|
| PDBID: | 9nb0 | | Status: | HPUB -- hold until publication | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and asymmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional expansion sequence | | Authors: | Shields, E.T., Snow, C.D. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9lvn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | | Authors: | Hu, R.K., Feng, C.H. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n97 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8z | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649, class 2 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-051-22 at 1.60 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-10 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n8y | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 Bound to Agonist L-AP4 and PAM VU6005649 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9ia1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AgcA bound to 4-ethylguaiacol | | Authors: | Hinchen, D.J., Zahn, M., Wolf, M.E., Eltis, L.D., McGeehan, J.E. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9y | | Status: | HPUB -- hold until publication | | Title: | Visualization of the full-length Tse5-CT toxic fragment inside T6SS-dependent Tse5 effector | | Authors: | Altuna-Alvarez, J., Zabala-Zearreta, M., Albesa-Jove, D. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9x | | Status: | HPUB -- hold until publication | | Title: | Human GABARAP in complex with artificial peptide IM-2 | | Authors: | Wilms, J.A., McDonald, I., Willbold, D., Kritzer, J.A., Weiergraeber, O.H. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9ltn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of macrolide phosphotransferase from Klebsiella pneumoniae | | Authors: | Si, Y., Wen, H., Peng, D. | | Deposition date: | 2025-02-06 |
|
