| PDBID: | 9nx5 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a P. Aeruginosa Gyrase | | Authors: | Pedersen, L.C., Doetsch, P.W., Garcia-Villada, L., Degtyareva, N., Perera, U.L. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qng | | Status: | HPUB -- hold until publication | | Title: | FOXO3 pS413 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnh | | Status: | HPUB -- hold until publication | | Title: | Myc pS294 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qni | | Status: | HPUB -- hold until publication | | Title: | NOTCH4 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnj | | Status: | HPUB -- hold until publication | | Title: | Tau pS198 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnk | | Status: | HPUB -- hold until publication | | Title: | Tau pT245 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnl | | Status: | HPUB -- hold until publication | | Title: | BAD pS118 phosphopeptide binding to 14-3-3sigma | | Authors: | Pennings, M.A.M. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnm | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2 | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qns | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnn | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Affitin C10 - fused to a coiled-coil domain - in complex with a C2 symmetric 31unit aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Wang, L., Douat, C., Huc, I. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnq | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qny | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., KowaleWski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9qnx | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-25 |
|
| PDBID: | 9u7g | | Status: | HPUB -- hold until publication | | Title: | FGFR1 kinase domain with a macrocyclic compound 8g | | Authors: | Chen, X.J., Chen, Y.H. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nww | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single-particle cryo-EM structure of the first variant of mobilized colistin resistance (MCR-1) in its ligand-bound state | | Authors: | Zinkle, A.P., Bunuro-Batista, M., Herrera, C.M., Erramilli, S.K., Kloss, B., Ashraf, K.U., Nosol, K., Zhang, G., Cater, R.J., Marty, M.T., Kossiakoff, A.A., Trent, M.S., Nygaard, R., Stansfeld, P.J., Mancia, F. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a high affinity Lv-Hv tetrabody for the erythropoietin receptor | | Authors: | Singer, A.U., Bruce, H.A., Yang, N., Blazer, L.L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2025-03-24 | | Sequence: | >Entity 1
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKGGGGGEVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVSS
|
|
| PDBID: | 9nwl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of glycine-betaine demethylase subunit GbcA from Pseudomonas aeruginosa | | Authors: | Tan, K., Joachimiak, A., Munoz-Clares, R.A. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9nwx | | Status: | HPUB -- hold until publication | | Title: | Discovery of a Small Molecule ITK and Pan-TRK Kinase Inhibitor (PF-07245303) for the Potential Topical Treatment of Atopic Dermatitis | | Authors: | Liu, S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qms | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DNA-PK bound to 153 bp H2AX nucleosome with ATPyS | | Authors: | Hall, C., Chaplin, A.K. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmo | | Status: | HPUB -- hold until publication | | Title: | PLK1 PBD apo protein at 1.6A | | Authors: | Ren, L., Gasper, R., Vetter, I., Musacchio, A. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qn7 | | Status: | HPUB -- hold until publication | | Title: | Structure of talin in complex with a peptide fragment | | Authors: | Zacharchenko, T. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qmr | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9qn6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-24 |
|
