| PDBID: | 7i23 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016618-001 (A71EV2A-x1346) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i24 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0016733-001 (A71EV2A-x1445) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i25 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0025240-002 (A71EV2A-x1778) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i26 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0030304-001 (A71EV2A-x2304) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 7i27 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Group deposition of Coxsackievirus A16 (G-10) 2A protease in complex with inhibitors from the ASAP AViDD centre -- Crystal structure of Coxsackievirus A16 (G-10) 2A protease in complex with ASAP-0018402-002 (A71EV2A-x2458) | | Authors: | Lithgo, R.M., Fairhead, M., Koekemoer, L., Balcomb, B.H., Capkin, E., Chandran, A.V., Golding, M., Godoy, A.S., Aschenbrenner, J.C., Marples, P.G., Ni, X., Thompson, W., Tomlinson, C.W.E., Wild, C., Winokan, M., Xavier, M.-A.E., Kenton, N., Tucker, J., DiPoto, M., Lee, A., Fearon, D., von Delft, F. | | Deposition date: | 2025-03-03 |
|
| PDBID: | 9qal | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of Arkadia 2 RING domain | | Authors: | Marousis, K.D., Giannari, D., Seliami, A., Politi, M., Birkou, M., Bentrop, D., Episkopou, V., Spyroulias, G.A. | | Deposition date: | 2025-02-28 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9m1i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TBC-D-Arl2-beta-tubulin complex | | Authors: | Seong, Y.J., Kim, H.M., Byun, K.M., Park, Y.W., Roh, S.H. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nin | | Status: | HPUB -- hold until publication | | Title: | The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86 | | Authors: | Cartwright, J.J., Abiodun, W.O., Dass, R., Singleton, J.D., Doukov, T., Peterson, M.A., Moody, J.D. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q8r | | Status: | HPUB -- hold until publication | | Title: | Human ROCK1 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-25 | | Sequence: | >Entity 1
GASFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRY
|
|
| PDBID: | 9m0b | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of alpha-agarase AGA from Catenovulum maritimum | | Authors: | Zhang, X.M., Li, W.H., Han, X.D. | | Deposition date: | 2025-02-24 | | Release date: | 2026-02-24 |
|
| PDBID: | 9m0a | | Status: | HPUB -- hold until publication | | Title: | Structure of TqaM from Penicillium aethiopicum in complex with D-(+)-3-phenyllactic acid | | Authors: | Wang, H., Mori, T., Abe, I. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9igu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15 and RBFA (Inward conformation) (State M2) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9igt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Assembly intermediate of human mitochondrial ribosome small subunit bound to METTL15, RBFA, and mtIF2 (State M2.1) | | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | | Deposition date: | 2025-02-20 |
|
| PDBID: | 9ig9 | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 3 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ifk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with DK-2 | | Authors: | Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ig1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Kalirin/Rac1 in complex with DK-652 | | Authors: | Gray, J.L., Zaidman, D., Callens, M.C., von Delft, F., London, N., Brennan, P.E. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ift | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifu | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 1 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifw | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and compound 4 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ify | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD and NAD+ and coenzyme Q1 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifz | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor) bound to FAD | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ifm | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF UNSTACKED C2S2-TYPE PSII-LHCII SUPERCOMPLEX FROM PISUM SATIVUM | | Authors: | Klaiman, D., Fadeeva, M., Kandiah, E., Nelson, N. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndd | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer, combined core plus aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndw | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of core | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
