| PDBID: | 9l8v | | Status: | HPUB -- hold until publication | | Title: | PyrN C-terminl domain in complex with L-glutamyl-sulfamoyl-adenosine (GSA) | | Authors: | Du, Y.L., Zhao, G. | | Deposition date: | 2024-12-28 |
|
| PDBID: | 9l8q | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structures of Keap1-B4 complexes | | Authors: | Zhuang, C.L., Yu, R.Z. | | Deposition date: | 2024-12-28 | | Release date: | 2025-12-28 |
|
| PDBID: | 9l8j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a putative phosphate binding protein from Synechocystis sp. PCC 6803 reveals an evolutionary hotspot | | Authors: | Wang, C.Y., Ma, H.L., Lu, Y.P. | | Deposition date: | 2024-12-27 |
|
| PDBID: | 9l8e | | Status: | HPUB -- hold until publication | | Title: | Structure of Gh-TDH with Additional N-Terminus in Complex with Double-Stranded DNA Containing a 2-Nucleotide 5'' Overhang | | Authors: | Hsiao, P.Y., Wu, T.K., Chang, C.Y. | | Deposition date: | 2024-12-27 |
|
| PDBID: | 9mof | | Status: | HPUB -- hold until publication | | Title: | Structure of the bacteriophage T4 portal-neck-tail connector complex | | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | | Deposition date: | 2024-12-26 |
|
| PDBID: | 9mog | | Status: | HPUB -- hold until publication | | Title: | Structure of the distal part of the bacteriophage T4 tail | | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | | Deposition date: | 2024-12-26 |
|
| PDBID: | 9moh | | Status: | HPUB -- hold until publication | | Title: | Structure of the middle part of the bacteriophage T4 tail | | Authors: | Fokine, A., Zhu, J., Klose, T., Vago, F., Arnaud, C., Wang, Z., Khare, B., Rossmann, M.G., Chen, Z., Sun, L., Fang, Q., Kuhn, R., Rao, V.B. | | Deposition date: | 2024-12-26 |
|
| PDBID: | 9l6t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of flavin-dependent monooxygenase DpasF in complex with the substrate | | Authors: | Zhao, X.Y., Zhang, L.P., Zhu, Y.G., Zhang, C.S. | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9l6u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of flavin-dependent monooxygenase DpasF | | Authors: | Zhao, X.Y., Zhang, L.P., Zhu, Y.G., Zhang, C.S. | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9l72 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of flavin-dependent monooxygenase DpasF mutant-K67A, in complex with the final product | | Authors: | Zhao, X.Y., Zhang, L.P., Zhu, Y.G., Zhang, C.S. | | Deposition date: | 2024-12-25 |
|
| PDBID: | 9mo3 | | Status: | HPUB -- hold until publication | | Title: | LINE-1 Reverse Transcriptase bound to an incorporated inhibitor-terminated DNA primer RNA template duplex and dTTP as the incoming base | | Authors: | Nichols, C., Viacava Follis, A. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9mo1 | | Status: | HPUB -- hold until publication | | Title: | LINE-1 Reverse Transcriptase bound to a DNA primer RNA template duplex and triphosphate nucleoside inhibitor as the incoming base | | Authors: | Nichols, C., Viacava Follis, A. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9hv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GSK3b in complex with ARN25657 | | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6g | | Status: | HPUB -- hold until publication | | Title: | Cocrystallization of the flavin-dependent monooxygenase DpasF with the substrate leads to its complex with the product | | Authors: | Zhao, X.Y., Zhang, L.P., Zhu, Y.G., Zhang, C.S. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6p | | Status: | HPUB -- hold until publication | | Title: | Cryo-electron microscopic structure of a highly efficient ochratoxin detoxification enzyme LlADH | | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., Niu, D., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Guo, R.-T., Chen, C.-C. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9l6h | | Status: | HPUB -- hold until publication | | Title: | complex structure of methyltransferases SMYD2 and inhibitor (14) | | Authors: | Sun, Y.L., Lu, J., Lu, W.C., Zhao, K.H., Liu, Y.H., Cao, L.H. | | Deposition date: | 2024-12-24 |
|
| PDBID: | 9mno | | Status: | HPUB -- hold until publication | | Title: | Structure of the TelA-associated type VII secretion system chaperone LcpA in complex with the chaperone binding site of TelA | | Authors: | Garrett, S.R., Kim, Y., Whitney, J.C. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM10-30 | | Authors: | Nguyen, T.K.Y., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-73 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mns | | Status: | HPUB -- hold until publication | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM1-36 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9mnu | | Status: | HPUB -- hold until publication | | Title: | Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM11-48 | | Authors: | Nguyen, T.K.Y., Stanfield, R.L., Wilson, I.A. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hul | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GSK3b in complex with ARN25423 | | Authors: | Dalle Vedove, A., Di Martino, R.M.C., Storici, P., Girotto, S., Cavalli, A., Bottegoni, G. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9hup | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F194 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9huu | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F223 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 9huv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma brucei PTR1 (TbPTR1) in complex with inhibitor F224 | | Authors: | Landi, G., Pozzi, C., Mangani, S. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
