| PDBID: | 8w5r | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab53 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5u | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of QbN10F-Ab40 | | Authors: | Bao, K.Y., Li, R.H., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5v | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of QbN10K-Ab40 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5w | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab8 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5l | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab16 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5m | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab17 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-27 | | Release date: | 2025-02-27 |
|
| PDBID: | 8w5d | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab1 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-26 | | Release date: | 2025-02-26 |
|
| PDBID: | 8w5e | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab4 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-26 | | Release date: | 2025-02-26 |
|
| PDBID: | 8w5f | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab6 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-26 | | Release date: | 2025-02-26 |
|
| PDBID: | 8w5g | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab7 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-26 | | Release date: | 2025-02-26 |
|
| PDBID: | 8w5h | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab10 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-26 | | Release date: | 2025-02-26 |
|
| PDBID: | 8w5i | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Qb-Ab14 | | Authors: | Bao, K.Y., Li, R.H., Hua, Z.L., Hou, B.D., Zhu, P. | | Deposition date: | 2023-08-26 | | Release date: | 2025-02-26 |
|
| PDBID: | 8qce | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Lactiplantibacillus paraplantarum DispLp | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | | Deposition date: | 2023-08-25 | | Release date: | 2025-02-25 |
|
| PDBID: | 8qb6 | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Terribacillus saccharophilus DispTs2 | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | | Deposition date: | 2023-08-24 | | Release date: | 2025-02-28 |
|
| PDBID: | 8qak | | Status: | HPUB -- hold until publication | | Title: | Dispersin from Terribacillus saccharophilus DispTs3 | | Authors: | Males, A., Moroz, O.V., Blagova, E., Munch, A., Hansen, G.H., Johansen, A.H., Ostergaard, L.H., Segura, D.R., Eddenden, A., Due, A.V., Gudmand, M., Salomon, J., Sorensen, S.R., Cairo, J.L.F., Pache, R.A., Vejborg, R.M., Davies, G.J., Wilson, K.S. | | Deposition date: | 2023-08-22 | | Release date: | 2025-02-28 |
|
| PDBID: | 8kdv | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Oval fibril at 3.5 Angstroms resolution | | Authors: | Li, D., Zhang, X., Zhu, P. | | Deposition date: | 2023-08-10 | | Release date: | 2025-02-26 |
|
| PDBID: | 8tqy | | Status: | HPUB -- hold until publication | | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | | Deposition date: | 2023-08-08 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8tog | | Status: | HPUB -- hold until publication | | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | | Deposition date: | 2023-08-03 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8tm9 | | Status: | HPUB -- hold until publication | | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, D_3_633_8x bound to peptide | | Authors: | Kennedy, M.A., Stoddard, B.L., Hicks, D.R. | | Deposition date: | 2023-07-28 | | Release date: | 2024-12-07 |
|
| PDBID: | 8tlp | | Status: | HPUB -- hold until publication | | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, D_3_633_8x without peptide | | Authors: | Kennedy, M.A., Stoddard, B.L., Hicks, D.R. | | Deposition date: | 2023-07-27 | | Release date: | 2024-12-07 |
|
| PDBID: | 8tf6 | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8pnf | | Status: | HPUB -- hold until publication | | Title: | HRV B14 virion proteins | | Authors: | Gil-Cantero, D., Mata, C.P., Mateu, M.G., Caston, J.R. | | Deposition date: | 2023-06-30 | | Release date: | 2024-12-30 |
|
| PDBID: | 8pe7 | | Status: | HPUB -- hold until publication | | Title: | Structure of human PGM5 in complex with Glucose-6-Phosphate | | Authors: | Puehringer, D. | | Deposition date: | 2023-06-13 | | Release date: | 2024-12-19 |
|
| PDBID: | 8jq0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of ZBTB48 ZF10-11-C in complex with CIITA promoter | | Authors: | Li, F.D., Wang, S.M. | | Deposition date: | 2023-06-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8jqa | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of mpox core protease in complex with the substrate analogue I-G18 | | Authors: | Lan, W., You, T., Li, D., Dong, X., Wang, H., Xu, J., Wang, W., Gao, Y., Yang, H. | | Deposition date: | 2023-06-13 | | Release date: | 2024-12-30 |
|
