| PDBID: | 7i8k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 61f bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 61c bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 21 bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 54l bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 14 bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 12 bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 18 bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 54m bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 7i8f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of 58e bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-03-12 |
|
| PDBID: | 9nq5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | D-Ornithine/D-lysine decarboxylase C387A complexed with HEPES, putrescine, and D-ornithine | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9npm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Composite map of three pairs of dimeric VRC36 Fabs bound to HIV-1 BG505.T332N DS-SOSIP.664 Env trimer | | Authors: | Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Zhou, T., Kwong, P.D. | | Deposition date: | 2025-03-11 |
|
| PDBID: | 9np0 | | Status: | HPUB -- hold until publication | | Title: | Structure of human annexin A1 in complex with 2C1 Fab | | Authors: | Nadezhdin, K.D., Sobolevsky, A.I. | | Deposition date: | 2025-03-10 |
|
| PDBID: | 9m6j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S. aureus protein A bound to a camelid single-domain antibody | | Authors: | Kong, Y., Shi, J.L., Wu, F.D., Zhao, T., Zhu, X.Y., Xu, Q.Y., Wang, R.B., Song, Y.D., Li, Q.X., Wang, Y.L., Gao, X.Y., Yang, Y.D., Wu, Y.L., Yang, Z.L., Yao, J.H., Ying, T.L. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S. aureus protein A bound to a camelid single-domain antibody | | Authors: | Kong, Y., Shi, J.L., Wu, F.D., Zhao, T., Zhu, X.Y., Xu, Q.Y., Wang, R.B., Song, Y.D., Li, Q.X., Wang, Y.L., Gao, X.Y., Yang, Y.D., Wu, Y.L., Yang, Z.L., Yao, J.H., Ying, T.L. | | Deposition date: | 2025-03-07 |
|
| PDBID: | 9m5k | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from PD homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9m5l | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of in situ amplified (ISA) alpha-synuclein fibrils from DLB homogenate | | Authors: | Cao, T.Y., Zhao, Q.Y., Liu, C., Li, D. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9nnv | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of CCoV-HuPn-2018 main protease bound to non-covalent inhibitor X77 at 2.15A | | Authors: | Jayashankar, U., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSAKYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVSENATLYFVYMHHLELGNGSHVGSNLEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGVNLQ
|
|
| PDBID: | 9nnw | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-050-23 at 1.55 A | | Authors: | Beechboard, S.N., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-06 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9nnz | | Status: | HPUB -- hold until publication | | Title: | A membrane protein with cofactor determined by single-particle CryoEM | | Authors: | Suder, D.S., Gonen, S. | | Deposition date: | 2025-03-06 |
|
| PDBID: | 9qd3 | | Status: | HPUB -- hold until publication | | Title: | Gluthathion-S-Transferase StyI of Gordonia rubripertincta CWB2 | | Authors: | Burnik, J., Lienkamp, A.C., Hofmann, E., Tischler, D. | | Deposition date: | 2025-03-05 |
|
| PDBID: | 9nng | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186I covalently bound to inhibitor GRL-051-22 at 1.90 A | | Authors: | Beechboard, S.N., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-03-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFIDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9m47 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Substrate Promiscuous Cytochrome P450 RufO | | Authors: | Saniya, D., Abhishek, S., Rajakumara, E. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9m4m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human DHODH in complex with Lapachol derivatives, 511-12 | | Authors: | Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9m4o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human DHODH in complex with Lapachol | | Authors: | Pemba, M.C., Sakurai, Y., Kurosaki, Y., Amalia, E., Inaoka, D.K., Davey, A.R., Shiba, T., Kita, K., Yasuda, J. | | Deposition date: | 2025-03-04 |
|
| PDBID: | 9nln | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Coxakievirus B3 IRES Domain V in Complex with a Fab | | Authors: | Das, N.K., Banna, H.A., Koirala, D. | | Deposition date: | 2025-03-03 |
|
