| PDBID: | 9ew7 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and CRAF phosphopeptide (pS259) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew6 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and BRAF phosphopeptide (pS365) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yxj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of 108-2 | | Authors: | Dong, C., Yan, X., Li, Y. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8yx0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Procambarus clarkii Arginine kinase | | Authors: | Yang, Y., Jin, T.C. | | Deposition date: | 2024-04-01 | | Release date: | 2025-04-01 |
|
| PDBID: | 9b8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 9b8n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor (10-S) | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8ywd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trehalose synthase mutant N253C from Deinococcus radiodurans | | Authors: | Ye, L.C., Chen, S.C. | | Deposition date: | 2024-03-30 |
|
| PDBID: | 8yvc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 8yvj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2592-2710 bound to H5.2 nanobody | | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yvo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2639-2707 bound to C4.2 nanobody | | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9b80 | | Status: | HPUB -- hold until publication | | Title: | Human endogenous FASN with 1,3-DBP - Class 1 focused modifying domain | | Authors: | Choi, W., Li, C., Chen, Y., Wang, Y., Cheng, Y. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9b7z | | Status: | HPUB -- hold until publication | | Title: | Human endogenous FASN with 1,3-DBP - Class 1 focused condensing domain | | Authors: | Choi, W., Li, C., Chen, Y., Wang, Y., Cheng, Y. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9euz | | Status: | HPUB -- hold until publication | | Title: | Glycoside hydrolase family 114 enzyme from Thermotoga maritima | | Authors: | Roth, C. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8yun | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of HNBP001-HCP | | Authors: | Chen, C.Z., Xia, Q.F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yuf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HEPN (Q64A) toxin | | Authors: | Jin, C., Jeon, C., Kim, D.H., Lee, B.J. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9b7a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of peroxiredoxin 1 with RA | | Authors: | Wu, Y., Xu, H., Luo, C. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9etx | | Status: | HPUB -- hold until publication | | Title: | KEAP1 BTB in complex with compound 23 | | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yue | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster | | Authors: | Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8ytt | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu0 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu2 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
