| PDBID: | 9ug0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA31-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ug1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA32-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA21-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA22-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uew | | Status: | HPUB -- hold until publication | | Title: | Wild-type Bacillus megaterium Penicillin G Acylase with Non-Covalently Bound Phenylacetic Acid | | Authors: | Kaewsasan, C., Rojviriya, C., Yuvaniyama, J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uey | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 1 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uez | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 2 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf0 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 3 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf1 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 4 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf2 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 5 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf3 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 6 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf4 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 7 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9uf5 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 8 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9qt7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt8 | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtc | | Status: | HPUB -- hold until publication | | Title: | HINT1 complexed with GS-441524 | | Authors: | Zimberger, C., Ferron, F. | | Deposition date: | 2025-04-08 | | Sequence: | >Entity 1
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
| PDBID: | 9o4t | | Status: | HPUB -- hold until publication | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o3d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | | Authors: | Flyak, A.I., Wilcox, X.E. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3m | | Status: | HPUB -- hold until publication | | Title: | K40F mutant of hCRBPII bound to fentanyl | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTFVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9qs4 | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qro | | Status: | HPUB -- hold until publication | | Title: | HINT1 complexed with GS-441524-MP | | Authors: | Zimberger, C., Ferron, F. | | Deposition date: | 2025-04-04 | | Sequence: | >Entity 1
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
|
|
| PDBID: | 9qrq | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsa | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome rotated-1 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-04 |
|
