PDBID: | 8y1v | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8y1w | Status: | HPUB -- hold until publication | Title: | Crystal structure of Thermococcus pacificus dUTPase complexed with dUMP. | Authors: | Fukui, K., Murakawa, T., Yano, T. | Deposition date: | 2024-01-25 |
|
PDBID: | 8y21 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB hetero-dimer from Mycobacterium tuberculosis complexed with substrate Palmitoyl-CoA | Authors: | Ganguly, S.S., Singh, B.K., Saha, R., De, S., Das, A.K. | Deposition date: | 2024-01-25 |
|
PDBID: | 8y1s | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsx | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsz | Status: | HPUB -- hold until publication | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Schulz, E.C., Wilmanns, M. | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsy | Status: | HPUB -- hold until publication | Title: | TRYPTOPHAN SYNTHASE measured via serial crystallography from a kapton HARE-chip (50 micron) | Authors: | Sung, S., Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., von Stetten, D., Mehrabi, P., Wilmanns, M., Schulz, E.C. | Deposition date: | 2024-01-25 |
|
PDBID: | 8rt1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BTV15 VP5 at pH 9.0 | Authors: | Sutton, G.C., Stuart, D.I. | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsr | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rss | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 | Sequence: | >Entity 1 MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
PDBID: | 8rso | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsw | Status: | HOLD -- hold until a certain date | Title: | Solution NMR structure of Pacsin 2 SH3 domain | Authors: | Tossavainen, H., Permi, P. | Deposition date: | 2024-01-25 | Release date: | 2024-02-22 |
|
PDBID: | 8rt0 | Status: | HPUB -- hold until publication | Title: | BTV-15 VP5 pH 6.0 | Authors: | Stuart, D.I., Sutton, G.C. | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8rsq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8vsz | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human GABAA receptor pi (GABRP) apo state | Authors: | Wang, Y., Klein, D. | Deposition date: | 2024-01-25 |
|
PDBID: | 8vt1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8vt6 | Status: | HPUB -- hold until publication | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | Authors: | Park, H., Feng, Y. | Deposition date: | 2024-01-25 |
|
PDBID: | 8vt4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-25 |
|
PDBID: | 8y1i | Status: | HOLD -- hold until a certain date | Title: | Structure of guanosine-2''''-fluorinated [d(AACCGGTT)]2 | Authors: | Gao, R.Q., Cao, C., Tang, G.L. | Deposition date: | 2024-01-24 | Release date: | 2025-01-24 |
|
PDBID: | 8rs4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-24 |
|
PDBID: | 8rsh | Status: | HPUB -- hold until publication | Title: | Lysozyme measured via serial crystallography from a silicon HARE chip | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs1 | Status: | HPUB -- hold until publication | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (125 micron) | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs6 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-24 |
|
PDBID: | 8rs2 | Status: | HPUB -- hold until publication | Title: | Thaumatin measured via serial crystallography from a silicon HARE-chip. | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sihyun, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | Deposition date: | 2024-01-24 |
|