Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9o2t
Status:HPUB -- hold until publication
Title:BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 3 (3 Fabs bound)
Authors:DeLaitsch, A.T., Bjorkman, P.J.
Deposition date:2025-04-04
PDBID:9o2x
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (S)-betahydroxyBocK charged NH-tRNAPyl
Authors:Majumdar, C., Kent, A., Hamlish, N., Zhu, C., Cate, J.
Deposition date:2025-04-04
PDBID:9o2u
Status:HPUB -- hold until publication
Title:BG505 SOSIP in complex with 007 bNAb IgG1 - trimer-dimer class
Authors:DeLaitsch, A.T., Bjorkman, P.J.
Deposition date:2025-04-04
PDBID:9o35
Status:HPUB -- hold until publication
Title:Crystal structure of DoxA in complex with daunorubicin
Authors:Newmister, S.A., Harte, R.J., Kim, R.Q., Metsa-Ketela, M., Sherman, D.H.
Deposition date:2025-04-04
PDBID:9qs4
Status:HPUB -- hold until publication
Title:Structure of glycocin glycosyltransferase SacS from Streptomyces platensis
Authors:Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C.
Deposition date:2025-04-04
PDBID:9qs9
Status:AUTH -- processed, waiting for author review and approval
Title:One ring nuclease to rule them all: the CRISPR-associated enzyme Crn4 degrades all cyclic oligoadenylate signalling species
Authors:McMahon, S.A., Chi, H., Hoikkala, V., Gloster, T.M., White, M.F.
Deposition date:2025-04-04
PDBID:9qrr
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of glycocin glycosyltransferase SacS from Streptomyces platensis
Authors:Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C.
Deposition date:2025-04-04
PDBID:9qsa
Status:HPUB -- hold until publication
Title:Mouse Ribosome rotated-1 PRE state
Authors:Santo, P.E., Astier, A., Plisson-Chastang, C.
Deposition date:2025-04-04
PDBID:9qrt
Status:HPUB -- hold until publication
Title:FSP1 (tetrapod ancestor; L323A mutant) bound to FAD and NAD+ and compound 2
Authors:Cecchini, D., Mattevi, A.
Deposition date:2025-04-04
PDBID:9qs1
Status:HPUB -- hold until publication
Title:Tetrapodal ancestor of L-amino acid oxidases
Authors:Massari, M., Mattevi, A.
Deposition date:2025-04-04
PDBID:9qsb
Status:HPUB -- hold until publication
Title:The solution structure of the cyanobacterial calcium binding protein CSE at 293 K
Authors:Kleusberg, F., Scholl, J., Selim, K.A., Coles, M.
Deposition date:2025-04-04
Sequence:

>Entity 1


GSSHHHHHHSSGLVPRGSHMATEQELQSLFNTLDRDQDGKISINELFLSPGLSAVISSETNTNSPQELLVQYDSDQDGSITFEELKKAVKKASNLT
PDBID:9qrq
Status:HPUB -- hold until publication
Title:Structure of glycocin glycosyltransferase SacS from Streptomyces platensis
Authors:Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C.
Deposition date:2025-04-04
PDBID:9uc5
Status:HPUB -- hold until publication
Title:Mini-protein binder of N-terminal domain of nucleocapsid protein of SARS-CoV2
Authors:Khakerwala, Z., Kumar, A., Makde, R.D.
Deposition date:2025-04-03
PDBID:9o18
Status:HPUB -- hold until publication
Title:Fab1504 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein
Authors:Moskovitz, R., Wilson, I.A.
Deposition date:2025-04-03
PDBID:9o1a
Status:HPUB -- hold until publication
Title:Pseudomonas aeruginosa ATPase State1 F1Fo focused
Authors:Stewart, A.G., Sobti, M.
Deposition date:2025-04-03
PDBID:9o1e
Status:HPUB -- hold until publication
Title:Pseudomonas aeruginosa ATPase State2a Fo focused
Authors:Stewart, A.G., Sobti, M.
Deposition date:2025-04-03
PDBID:9o1i
Status:HPUB -- hold until publication
Title:TMEM16F in liposomes in the absence of Ca2+ (contracted state)
Authors:Feng, Z., Accardi, A.
Deposition date:2025-04-03
PDBID:9o1l
Status:HPUB -- hold until publication
Title:TMEM16F in liposomes in the absence of Ca2+ (expanded state)
Authors:Feng, Z., Accardi, A.
Deposition date:2025-04-03
PDBID:9o1o
Status:HPUB -- hold until publication
Title:TMEM16F R478E/E604R mutant in liposomes in the presence of Ca2+
Authors:Feng, Z., Accardi, A.
Deposition date:2025-04-03
PDBID:9o1q
Status:HPUB -- hold until publication
Title:TMEM16F D409G mutant in liposomes in the presence of Ca2+ (active state)
Authors:Feng, Z., Accardi, A.
Deposition date:2025-04-03
PDBID:9o14
Status:HPUB -- hold until publication
Title:Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2
Authors:Seo, H.-S., DeAngelo, T.M., Bird, G.H., Walensky, L.D., Dhe-Paganon, S.
Deposition date:2025-04-03
PDBID:9o15
Status:HPUB -- hold until publication
Title:Crystal Structure of BCL-2 (G101V) mutant in complex with a stapled BAD BH3 peptide BAD SAHB 4.2
Authors:Seo, H.-S., DeAngelo, T.M., Bird, G.H., Walensky, L.D., Dhe-Paganon, S.
Deposition date:2025-04-03
PDBID:9o16
Status:HPUB -- hold until publication
Title:Crystal Structure of human BCL-2 (R129L) mutant in complex with a stapled BAD BH3 peptide BAD SAHB 4.2
Authors:Seo, H.-S., DeAngelo, T.M., Bird, G.H., Walensky, L.D., Dhe-Paganon, S.
Deposition date:2025-04-03
PDBID:9o1m
Status:HPUB -- hold until publication
Title:TMEM16F in liposomes in the presence of Ca2+ (closed state)
Authors:Feng, Z., Accardi, A.
Deposition date:2025-04-03
PDBID:9o1n
Status:HPUB -- hold until publication
Title:TMEM16F in liposomes in the presence of Ca2+ (active state)
Authors:Feng, Z., Accardi, A.
Deposition date:2025-04-03

238268

数据于2025-07-02公开中

PDB statisticsPDBj update infoContact PDBjnumon