| PDBID: | 9o2t | | Status: | HPUB -- hold until publication | | Title: | BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 3 (3 Fabs bound) | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2x | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (S)-betahydroxyBocK charged NH-tRNAPyl | | Authors: | Majumdar, C., Kent, A., Hamlish, N., Zhu, C., Cate, J. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2u | | Status: | HPUB -- hold until publication | | Title: | BG505 SOSIP in complex with 007 bNAb IgG1 - trimer-dimer class | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o35 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DoxA in complex with daunorubicin | | Authors: | Newmister, S.A., Harte, R.J., Kim, R.Q., Metsa-Ketela, M., Sherman, D.H. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs4 | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | One ring nuclease to rule them all: the CRISPR-associated enzyme Crn4 degrades all cyclic oligoadenylate signalling species | | Authors: | McMahon, S.A., Chi, H., Hoikkala, V., Gloster, T.M., White, M.F. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsa | | Status: | HPUB -- hold until publication | | Title: | Mouse Ribosome rotated-1 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qrt | | Status: | HPUB -- hold until publication | | Title: | FSP1 (tetrapod ancestor; L323A mutant) bound to FAD and NAD+ and compound 2 | | Authors: | Cecchini, D., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qs1 | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9qsb | | Status: | HPUB -- hold until publication | | Title: | The solution structure of the cyanobacterial calcium binding protein CSE at 293 K | | Authors: | Kleusberg, F., Scholl, J., Selim, K.A., Coles, M. | | Deposition date: | 2025-04-04 | | Sequence: | >Entity 1
GSSHHHHHHSSGLVPRGSHMATEQELQSLFNTLDRDQDGKISINELFLSPGLSAVISSETNTNSPQELLVQYDSDQDGSITFEELKKAVKKASNLT
|
|
| PDBID: | 9qrq | | Status: | HPUB -- hold until publication | | Title: | Structure of glycocin glycosyltransferase SacS from Streptomyces platensis | | Authors: | Krummhaar, M., Langhans, A., Singh, M., Seeberger, P.H., Koksch, B., Roth, C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9uc5 | | Status: | HPUB -- hold until publication | | Title: | Mini-protein binder of N-terminal domain of nucleocapsid protein of SARS-CoV2 | | Authors: | Khakerwala, Z., Kumar, A., Makde, R.D. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o18 | | Status: | HPUB -- hold until publication | | Title: | Fab1504 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1a | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas aeruginosa ATPase State1 F1Fo focused | | Authors: | Stewart, A.G., Sobti, M. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1e | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas aeruginosa ATPase State2a Fo focused | | Authors: | Stewart, A.G., Sobti, M. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1i | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the absence of Ca2+ (contracted state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1l | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the absence of Ca2+ (expanded state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1o | | Status: | HPUB -- hold until publication | | Title: | TMEM16F R478E/E604R mutant in liposomes in the presence of Ca2+ | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1q | | Status: | HPUB -- hold until publication | | Title: | TMEM16F D409G mutant in liposomes in the presence of Ca2+ (active state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o14 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of BCL-2 in complex with a stapled BAD BH3 peptide BAD SAHB 4.2 | | Authors: | Seo, H.-S., DeAngelo, T.M., Bird, G.H., Walensky, L.D., Dhe-Paganon, S. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o15 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of BCL-2 (G101V) mutant in complex with a stapled BAD BH3 peptide BAD SAHB 4.2 | | Authors: | Seo, H.-S., DeAngelo, T.M., Bird, G.H., Walensky, L.D., Dhe-Paganon, S. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o16 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human BCL-2 (R129L) mutant in complex with a stapled BAD BH3 peptide BAD SAHB 4.2 | | Authors: | Seo, H.-S., DeAngelo, T.M., Bird, G.H., Walensky, L.D., Dhe-Paganon, S. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1m | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the presence of Ca2+ (closed state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9o1n | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the presence of Ca2+ (active state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
