| PDBID: | 9o4t | | Status: | HPUB -- hold until publication | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt8 | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtb | | Status: | HPUB -- hold until publication | | Title: | Apo form of the L-protein from Rift Valley Fever Virus (LPapo) | | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytoplasmic 60S maturation intermediate (State D1) | | Authors: | Kargas, V., Warren, A.J. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9udw | | Status: | HPUB -- hold until publication | | Title: | G6P bound SLC37A2 in a symmetric inward-facing state by adding G6P | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA42 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9ue0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA49 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udx | | Status: | HPUB -- hold until publication | | Title: | apo SLC37A2 in a symmetric outward-facing state by adding G6P | | Authors: | Sun, L., Liu, X., Lai, Q. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | | Authors: | Flyak, A.I., Wilcox, X.E. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3b | | Status: | HPUB -- hold until publication | | Title: | PKM2 bound to MCTI-566 | | Authors: | Stuckey, J.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mn(III)-substituted Wells-Dawson binding to Hen Egg-White Lysozyme (HEWL) | | Authors: | Moussawi, M.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsn | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallized with indole-3-acetic acid | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qso | | Status: | HPUB -- hold until publication | | Title: | Tetrapodal ancestor of L-amino acid oxidases co-crystallised with indole-3-pyruvate | | Authors: | Massari, M., Mattevi, A. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qsm | | Status: | HPUB -- hold until publication | | Title: | small molecule inhibitor in complex with PD-L1 | | Authors: | Muszak, D., Kocik-Krol, J., Zaber, J., Kruc, O., Palej, U., Fijolkowska, K., Maslanka, A., Magiera-Mularz, K., Plewka, J., Stec, M., Siedlar, M., Musielak, B., Kitel, R., Skalniak, L., Surmiak, E. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9qsj | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of SKM-70S ribosomal stalled complex in the A-tRNA positioned (Body open) state. | | Authors: | Morici, M., Corazza, M., Safdari, H.A., Wilson, D.N. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9ucg | | Status: | HPUB -- hold until publication | | Title: | A Fab structure with a covalent bond | | Authors: | Makabe, K., Nakanishi, T. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM Structure of VgrG4 from Hypervirulent Klebsiella pneumoniae kp52.145 | | Authors: | Noske, G.D., Dominguez-Antty, J.H., Paula, T.G., Aleixo, M.A.A., Portugal, R.V., Cunha, M.M.L., Amorim, G.C. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2y | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of WT E.coli ribosome 70S subunit with complexed with mRNA, P-site fMet-NH-tRNAfMet and A-site (R) beta-2-hydroxy-BocLysine acid charged NH-tRNAPyl | | Authors: | Majumdar, C., Cate, J.H.D. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2q | | Status: | HPUB -- hold until publication | | Title: | BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 0 (unbound) | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2r | | Status: | HPUB -- hold until publication | | Title: | BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 1 (1 Fab bound) | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2025-04-04 |
|
| PDBID: | 9o2s | | Status: | HPUB -- hold until publication | | Title: | BG505-DS SOSIP in complex with 007 bNAb Fabs - Class 2 (2 Fabs bound) | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2025-04-04 |
|
