PDBID: | 9l5w | Status: | HPUB -- hold until publication | Title: | FADD-DED filaments coordinate complex IIa assembly during TNF-induced apoptosis | Authors: | Tan, Y.B., Luo, D. | Deposition date: | 2024-12-23 |
|
PDBID: | 7htz | Status: | HPUB -- hold until publication | Title: | PanDDA analysis group deposition -- Crystal Structure of FatA in complex with Z69092635 | Authors: | Kot, E., Ni, X., Tomlinson, C.W.E., Fearon, D., Aschenbrenner, J.C., Fairhead, M., Koekemoer, L., Marx, M.L., Wright, N.D., Mulholland, N.P., Montgomery, M.G., von Delft, F. | Deposition date: | 2024-12-23 |
|
PDBID: | 9mnp | Status: | HPUB -- hold until publication | Title: | Crystal structure of mutant variant of mAb CV3-25 Fab in complex with SARS-CoV-2 spike stem helix peptide | Authors: | Chandravanshi, M., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-12-23 |
|
PDBID: | 9l4q | Status: | HPUB -- hold until publication | Title: | Crystal structure of the carbamoyl N-methyltransferase Asc-Orf2 complexed with SAH | Authors: | Li, Z.Y., Zhu, D.Y., Shen, Y.M. | Deposition date: | 2024-12-20 |
|
PDBID: | 9mmp | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CRAF/MEK1/14-3-3 complex (autoinhibited conformation) | Authors: | Jang, D.M., Jeon, H., Eck, M.J. | Deposition date: | 2024-12-20 |
|
PDBID: | 9mmr | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CRAF/MEK1/14-3-3 complex (open monomer conformation, CRAF Y340D/Y341D mutant) | Authors: | Jang, D.M., Jeon, H., Eck, M.J. | Deposition date: | 2024-12-20 |
|
PDBID: | 9mmq | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CRAF/MEK1 complex (kinase domain) | Authors: | Jang, D.M., Jeon, H., Eck, M.J. | Deposition date: | 2024-12-20 |
|
PDBID: | 9mms | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of CRAF/MEK1 complex (kinase domain, CRAF Y340D/Y341D mutant) | Authors: | Jang, D.M., Jeon, H., Eck, M.J. | Deposition date: | 2024-12-20 |
|
PDBID: | 9mlj | Status: | HPUB -- hold until publication | Title: | X-ray structure of SARS-CoV-2 main protease covalently bound to compound GRL-050-23 at 1.6 A | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | Deposition date: | 2024-12-19 | Sequence: | >Entity 1 SGFRKMAFPSGKVEGCMVQVT(CSO)GTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD(CSO)VSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
PDBID: | 9ht7 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 47, with P-site and A-site tRNAs | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | Deposition date: | 2024-12-19 |
|
PDBID: | 9mlx | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crosslinked complex of ketosynthase FabB mutant FabBG107M and acyl carrier protein AcpP from E.coli with C12 crosslinker | Authors: | Jiang, Z., Sankaran, B., Burkart, M.D., Fox, J.M. | Deposition date: | 2024-12-19 |
|
PDBID: | 9mle | Status: | HPUB -- hold until publication | Title: | Crystal structure of Asp49 Phospholipase A2 isolated from Lachesis muta | Authors: | Leonardo, D.A., Vargas, J.A., Pereira, H.M., Garratt, R.C. | Deposition date: | 2024-12-19 |
|
PDBID: | 9mkv | Status: | HPUB -- hold until publication | Title: | FnoCas12a bridge helix variant state 3 | Authors: | Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Rajan, R. | Deposition date: | 2024-12-18 |
|
PDBID: | 9hs5 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of an agonist bound to the active melanocortin-4 receptor (MC4R) in complex with the heterotrimeric Gs protein at 3.06 A resolution. | Authors: | Heyder, N.A., Speck, D., Schmidt, A., Hilal, T., Scheerer, P. | Deposition date: | 2024-12-18 |
|
PDBID: | 9mkx | Status: | HPUB -- hold until publication | Title: | FnoCas12a bridge helix variant state 4b | Authors: | Ganguly, C., Thomas, L.M., Aribam, S.D., Martin, L., Rajan, R. | Deposition date: | 2024-12-18 |
|
PDBID: | 9hr7 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of an endogenous agonist bound to the active melanocortin-4 receptor (MC4R) in complex with the heterotrimeric Gs protein at 2.65 A resolution. | Authors: | Heyder, N.A., Speck, D., Schmidt, A., Hilal, T., Scheerer, P. | Deposition date: | 2024-12-17 |
|
PDBID: | 9hr8 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of the synthetic high-affinity agonist bound to the active melanocortin-4 receptor (MC4R) in complex with the heterotrimeric Gs protein at 2.66 A resolution. | Authors: | Heyder, N.A., Speck, D., Schmidt, A., Hilal, T., Scheerer, P. | Deposition date: | 2024-12-17 |
|
PDBID: | 9l2o | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure and rational engineering of a novel efficient ochratoxin A-detoxifying amidohydrolase | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-17 |
|
PDBID: | 9l2t | Status: | HPUB -- hold until publication | Title: | Cryo-electron microscopic structure of a novel amidohydrolase with three mutations | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-17 |
|
PDBID: | 9l36 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-electron microscopic structure of a novel amidohydrolase ADH3 triple mutation | Authors: | Dai, L.H., He, B.Y., Hu, Y.M., Xu, Y.H., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-17 |
|
PDBID: | 9mkh | Status: | AUTH -- processed, waiting for author review and approval | Title: | Open state of D-ornithine 4,5-aminomutase from Fervidobacterium nodosum | Authors: | Pham, K., Poore, A., Tian, S., Vago, F. | Deposition date: | 2024-12-17 |
|
PDBID: | 9mki | Status: | AUTH -- processed, waiting for author review and approval | Title: | Closed state of D-ornithine 4,5-aminomutase from Fervidobacterium nodosum | Authors: | Pham, K., Tian, S. | Deposition date: | 2024-12-17 |
|
PDBID: | 9hpz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the wild-type flagellar filament from Roseburia hominis | Authors: | Bell, M.E.W., Koch, I., Hipp, K., Hartmann, M.D., Merino, F., Ley, R.E. | Deposition date: | 2024-12-16 | Release date: | 2025-12-16 |
|
PDBID: | 9hqp | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of mouse TMEM16F-YFP purified and plunged using MISO (microfluidic isolation) | Authors: | De Gieter, S., Eluru, G., Schenck, S., Stroobants, A., Efremov, R.G., Brunner, J.D. | Deposition date: | 2024-12-16 |
|
PDBID: | 9hqn | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of bovine TMEM206 | Authors: | Brunner, J.D., Schenck, S., De Gieter, S. | Deposition date: | 2024-12-16 |
|