Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9i3h
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CP of RHDV mutant - N15
Authors:Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R.
Deposition date:2025-01-23
PDBID:9i3k
Status:HPUB -- hold until publication
Title:Asymmetric cryo-EM reconstruction of the full-length E. coli transmembrane formate transporter FocA
Authors:Tueting, C., Janson, K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L.
Deposition date:2025-01-23
PDBID:9i3j
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CP of empty RHDV virion
Authors:Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R.
Deposition date:2025-01-23
PDBID:9lp2
Status:HPUB -- hold until publication
Title:Crystal structure of de novo designed amantadine induced heterodimer dAID23.4
Authors:Qihan, J., Longxing, C.
Deposition date:2025-01-23
PDBID:9myq
Status:HPUB -- hold until publication
Title:Mini-alphaA crystallin
Authors:Sroge, C.D., Padilla, M.S.T.L., Zhu, J., Martin, R.W.
Deposition date:2025-01-22
PDBID:9mzc
Status:HPUB -- hold until publication
Title:anti-IL6 designed Fab
Authors:Kiefer, J.R., Alberstein, R.G., Frey, N.C., Seeger, F., Dou, Y., Huo, C., Watkins, A.M., Leaver-Fay, A., Hofmann, J.L., Gligorijevic, V., Bonneau, R.
Deposition date:2025-01-22
Sequence:

>Entity 1


EVQLVESGGGLVQPGRSMKLSCAASGFIFSNYGMAWVRQAPKKGLEWVAYINYDGGTTYYRDSVKGRFTISRDNAKSTLYLQMDSLRSEDTATYYCTTGYYYDGSYYYDRFVYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

>Entity 2


DIQMTQSPSFLSASEGERVTLNCRASQNINKYLDWYQQKLGEAPKLLIYNTNNLHTGIPSRFSGSGSGTDYTITISSLQPEDVATYFCLQRNSWYTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
PDBID:9i38
Status:HPUB -- hold until publication
Title:Solution structure of the de novo designed monoheme protein m4D2 with bound iron(III) 2,4-dimethyldeuteroporphyrin IX
Authors:Williams, C., Hutchins, G.H., Molinaro, P.M., Berrones-Reyes, J.C., Lichtenstein, B.R., Koder, R.L., Anderson, J.L.R.
Deposition date:2025-01-22
PDBID:9i3b
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 8s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9i3c
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9i3d
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 10s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9i3e
Status:WAIT -- processing started, waiting for author input to continue processing
Title:CP of RHDV mutant - 29N
Authors:Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J.
Deposition date:2025-01-22
PDBID:9i3a
Status:HPUB -- hold until publication
Title:Isopenicillin N synthase co-crystallised with Fe and ACdV after 6s O2 exposure
Authors:Rabe, P., Schofield, C.J.
Deposition date:2025-01-22
PDBID:9lnt
Status:HPUB -- hold until publication
Title:Crystal structure of de novo designed amantadine induced homotrimer mAIT03
Authors:Qihan, J., Longxing, C.
Deposition date:2025-01-22
PDBID:9lns
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of de novo designed amantadine induced homotrimer dAIT17
Authors:Qihan, J., Longxing, C.
Deposition date:2025-01-22
PDBID:9lo8
Status:HPUB -- hold until publication
Title:Twentieth polymer Msp1 from S.cerevisiae(with a catalytic dead mutation) in complex with an unknown peptide substrate
Authors:Chengdong, H., Simin, W., Xuan, C.
Deposition date:2025-01-22
PDBID:9lnh
Status:HOLD -- hold until a certain date
Title:Crystal structure of Peroxiredoxin I in complex with compound LC-PDin20
Authors:Wang, Z., Luo, C.
Deposition date:2025-01-21
Release date:2026-01-21
PDBID:9mxq
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer
Authors:Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Anderson, K.S.
Deposition date:2025-01-20
PDBID:9mxr
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor
Authors:Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S.
Deposition date:2025-01-20
PDBID:9mxs
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 Homodimer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy] phenoxy}naphthalene-2-carbonitrile, a Non-nucleoside Inhibitor, with an Additional Pocket of Density
Authors:Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S.
Deposition date:2025-01-20
PDBID:9mxt
Status:HPUB -- hold until publication
Title:Cryo-EM Structure of HIV-1 Reverse Transcriptase p66 tetramer in Complex with 5-{2-[2-(2-oxo-4-sulfanylidene-3,4-dihydropyrimidin-1(2H)-yl)ethoxy]phenoxy}naphthalene-2-carbonitrile (JLJ648), a Non-nucleoside Inhibitor
Authors:Hollander, K., Devarkar, S.C., Tang, S., Ma, S., Xiong, Y., Jorgensen, W.L., Anderson, K.S.
Deposition date:2025-01-20
PDBID:9ln7
Status:HPUB -- hold until publication
Title:Alpha-7 nicotinic acetylcholine receptor bound to inhibitory bicyclic peptide KP2007 in a resting state.
Authors:Chen, H., Sun, D., Tian, C.
Deposition date:2025-01-20
PDBID:9lmg
Status:HPUB -- hold until publication
Title:Crystal structure of LooH
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19
PDBID:9lmh
Status:HPUB -- hold until publication
Title:Crystal structure of LooH in complex with FAD
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19
PDBID:9lmi
Status:HPUB -- hold until publication
Title:Crystal structure of LooH in complex with Trp
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19
PDBID:9lmj
Status:HPUB -- hold until publication
Title:Crystal structure of LooH in complex with I-Trp
Authors:Zhang, F., Li, Y.C., Zhu, Y., Wang, K., Chang, C.Y., Xu, Z.
Deposition date:2025-01-19

237735

数据于2025-06-18公开中

PDB statisticsPDBj update infoContact PDBjnumon