| PDBID: | 9qqw | | Status: | HPUB -- hold until publication | | Title: | LvrB - active conformation | | Authors: | Agustoni, E., Mechaly, A., Rizza, J.D., Beriashvili, D., Pluhackova, K., Isaikina, P., Trajtenberg, F., Muntener, T., Wunder, E., Ko, A., Schirmer, T., Buschiazzo, A., Hiller, S. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qqu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD | | Authors: | Pinotis, N., Bell, R., Williams, M.A. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qqy | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB XRPP experiment (1000 kGy)-PUMP | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Maly, M., Owen, R.L. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9qr2 | | Status: | HPUB -- hold until publication | | Title: | LvrB inactive | | Authors: | Agustino, E., Buschiazzo, A., Hiller, S., Beriashvili, D. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9o02 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfOgg1-K122S mutant bound to 8-OG DNA duplex in an intermediate state | | Authors: | Huffman, J.L., Syed, A., Tang, H.Y.H., Arvai, A.S., Mol, C.D., Tainer, J.A. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9o03 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfOgg1:8OG-DNA duplex in a product-bound state | | Authors: | Arvai, A.S., Syed, A., Huffman, J.L., Mol, C.D., Hitomi, K., Tainer, J.A. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9nzy | | Status: | HPUB -- hold until publication | | Title: | Structure of Methanogen MtxX (Methanogen Marker Protein MMP4) from Methanothermobacter thermautotrophicus | | Authors: | Sutherland-Smith, A.J., Carbone, V., Schofield, L.R., Ronimus, R.S. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qql | | Status: | HPUB -- hold until publication | | Title: | Mouse RPS15 P131 Mutant Ribosome POST translocation state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SKM-70S ribosomal stalled complex in the major state (vacant A-site, canon) | | Authors: | Morici, M., Corazza, M., Safdari, H.A., Wilson, D.N. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqp | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Mouse Ribosome rotated-2 PRE state | | Authors: | Santo, P.E., Astier, A., Plisson-Chastang, C. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9qqo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a beta-glycosidase from Prevotella sp. | | Authors: | Schwartz, M., Neiers, F. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9uaf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the OkaE-M71A mutant with a-ketoglutarate | | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9uag | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the OkaE-M71A mutant with a-ketoglutarate and okaramine A | | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9uah | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the OkaE-W79A mutant with a-ketoglutarate and okaramine A | | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9uac | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the OkaE-M64A mutant with a-ketoglutarate | | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9uad | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the OkaE-M64A mutant with a-ketoglutarate and okaramine A | | Authors: | Yu, J.J., Yan, W.P., Wang, X.Y. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfNth1:Tg-DNA duplex complex in a pre-intermediate state | | Authors: | Syed, A., Arvai, A.S., Tsai, C.L., Tainer, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AfNth1-K122A mutant bound to Tg-DNA duplex complex in an intermediate state | | Authors: | Hitomi, K., Arvai, A.S., Syed, A., Parikh, S., Tainer, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of vaccine elicited antibody 22F5 bound to the post-fusion conformation of the LayV-F glycoprotein. | | Authors: | Kumar, U., May, A., Acharya, P. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nz2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of antibody 22F5 in complex with pre-fusion stabilized LayV-F | | Authors: | May, A.J., Kumar, U., Acharya, P. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9nzf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fab MAM01 in complex with minor repeat region peptide from circumsporozoite protein | | Authors: | Jain, M., Wilson, I.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqe | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the SN230G6 Fab - HLA-A*02:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Schneider, S., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qqf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the WIM8E5 Fab - HLA-A*11:01 human alloantibody-HLA complex | | Authors: | Zampieri, V., Priddey, A., Humm, A.S., Pellegrini, E., Heidt, S., Kosmoliaptsis, V., Marquez, J.A. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 as isolated form at 1.07-A resolution | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 |
|
| PDBID: | 9qq5 | | Status: | HPUB -- hold until publication | | Title: | Mini-bacterioferritin from Candidatus Methanoperedens species BLZ2 in a partially oxidized state | | Authors: | Wissink, M., Wagner, T. | | Deposition date: | 2025-03-31 | | Sequence: | >Entity 1
MSQKIIDALNKDREEELSAIIQYMKHHYEGEGMESPAILEIFKSIAKSEMDHAEKLGERIVYLGGTPTKKPEPIAEGGDLKKMVQDDLAKENHAIEQYKEHIKLAIEEDDPTTRLMLEEILSDEEDHADTWQTLLKVKK
|
|
