| PDBID: | 9lps | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9n0k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE triple mutant (Ile12Phe, Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) in complex with 6-nitrobenzotriazole | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-24 | | Release date: | 2026-01-24 |
|
| PDBID: | 9n0o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-24 | | Release date: | 2026-01-24 |
|
| PDBID: | 9n0p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo EM structure of the Open tetramer from Mycobacterium Tuberculosis. | | Authors: | Gupta, J., Izard, T. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n10 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0w | | Status: | HPUB -- hold until publication | | Title: | HTLV-1 Gag capsid from immature particles | | Authors: | Arndt, W.G., Ramezani, A., Chen, B., Perilla, J.R., Zhang, W., Mansky, L.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GCGR-Gs complex with oxyntomodulin | | Authors: | Zhang, X., Jiang, Y., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n11 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3s | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A10B10 glyceraldehyde-3-phospahte dehydrogenase from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F., Del Giudice, A. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
