| PDBID: | 9ej7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of the mutant (R140Q and I319M) IDH2 homodimer | | Authors: | Forouhar, F., Hou, S., Wang, J., Wang, C., Limbad, C., Park, J., Zohrabian, S., Moskowitz, A., Correa, F., Takemoto, N., Waterman, A., Thompson, V., Kramer, K., Liu, E.M., de Stanchina, E., Xiao, W., Garippa, R., Reznik, E., Intlekofer, A.M. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9ejd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-B*07:02 with the 9-mer TP53 mutant peptide SPILTIITL | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2024-11-27 |
|
| PDBID: | 9hio | | Status: | HPUB -- hold until publication | | Title: | RKEC1 DNA aptamer bound to dopamine | | Authors: | Largy, E., Kaiyum, Y.A., Chao, E.H.P., Vialet, B., Johnson, P.E., Mackereth, C.D. | | Deposition date: | 2024-11-26 | | Sequence: | >Entity 1
(DT)(DT)(DG)(DA)(DA)(DG)(DG)(DT)(DT)(DC)(DG)(DT)(DT)(DC)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DT)(DG)(DG)(DA)(DG)(DT)
|
|
| PDBID: | 9eiq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HLA-B*07:02 with the 9-mer TP53 peptide RPILTIITL | | Authors: | Tan, K., Mallis, R.J., Reinherz, E.L. | | Deposition date: | 2024-11-26 |
|
| PDBID: | 9hia | | Status: | HPUB -- hold until publication | | Title: | K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP | | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | | Deposition date: | 2024-11-25 |
|
| PDBID: | 9hib | | Status: | HPUB -- hold until publication | | Title: | K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2) | | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | | Deposition date: | 2024-11-25 |
|
| PDBID: | 9hic | | Status: | HPUB -- hold until publication | | Title: | K166 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP | | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | | Deposition date: | 2024-11-25 |
|
| PDBID: | 9hhr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of VSV-Indiana glycoprotein (MUDD-SUMMERS strain) in its post-fusion conformation in complex with 8G5F11 Fab | | Authors: | Albertini, A., Minoves, M.J., OuldAli, M., Gaudin, Y., Schoehn, G., Zarkadas, E. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhn | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase I from Clostridium pasteurianum (CpI), variant T275Y | | Authors: | Veliju, A., Duan, J., Hofmann, E., Happe, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhz | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase I from Clostridium pasteurianum (CpI), variant T275H | | Authors: | Veliju, A., Duan, J., Hofmann, E., Happe, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hht | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase I from Clostridium pasteurianum (CpI), variant T275F | | Authors: | Veliju, A., Duan, J., Hofmann, E., Happe, T. | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9hhh | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease C111S of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhg | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9hhi | | Status: | HPUB -- hold until publication | | Title: | A rare open conformation for Ubl2 domain of papain-like protease without zinc of SARS-CoV2 | | Authors: | Freiherr von Scholley, G.L., Schaefer, M., Soler Lopez, M., Hillig, R., Mueller-Dieckmann, C., Kandiah, E. | | Deposition date: | 2024-11-21 | | Sequence: | >Entity 1
EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPENLYFQ
|
|
| PDBID: | 9eeo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, CTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eep | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP and succinate | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with PALA, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Bhatt, N., Pei, X., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9een | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eed | | Status: | HPUB -- hold until publication | | Title: | The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124 | | Authors: | Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
SMSLAATAWQRLEALFHRACQLPAAEREAFARAQAGDDASLRDDLLAMLAVESQATLRVRAPLKQAVAALRAPLPELPAGTRFGAWAIDRLIGAGGMGQVYLGHRADGAYEREVAIKLVAADALDAQGRALFEFECRLLAQMVHPAIAQIHDVGTDAHGQPYLVAEYLRGEPITWWCDEHRLSLHARVLLMLRVGEAVQHAHQKGVIHRDLKPSNVLVSEIDGRPMPGVIDFGIAVDATNPGMTYAHDRGTPGYMSPEQARGAQDVDARSDIYALGAMFYELSCGLAPVAGRDGVPQPPSQRVAAVPADARARICAARATTYQKLHEQLRDGLDAIVLRALEPQPGARYASVSALLDDLHRWLD
|
|
| PDBID: | 9ees | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in an expanded state complexed with CP, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eel | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, UTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
