| PDBID: | 9ne2 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne4 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the A-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9igh | | Status: | HPUB -- hold until publication | | Title: | Structure of human Bcl-xL in complex with small molecule inhibitor | | Authors: | Dokurno, P., Novak, T., Kotschy, A., Hubbard, R.E., Davidson, J., Murray, J.B. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9igb | | Status: | HPUB -- hold until publication | | Title: | Structure of human Bcl-xL in complex with small molecule inhibitor | | Authors: | Dokurno, P., Novak, T., Kotschy, A., Hubbard, R.E., Murray, J.B. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nd6 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 50s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 50s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd7 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 75s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 for 75s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd8 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH8-pH9.5; 95s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 95s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9nd9 | | Status: | HPUB -- hold until publication | | Title: | [T:Ag+/Hg2+:T--(pH11-pH9.5; 5s)] Metal-mediated DNA base pair in tensegrity triangle grown at pH 8 and soaked in pH 9.5 Ag/Hg for 5s | | Authors: | Lu, B., Vecchioni, S. | | Deposition date: | 2025-02-17 |
|
| PDBID: | 9lw0 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cytochrome P450PL2 from Parvibaculum lavamentivorans DS-1 | | Authors: | Cui, H.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nb3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of quaternary complex of human phosphoribosylglycinamidine synthase with thioester intermediate bound (at glutaminase site) and AMPPNP and FGAR (at synthase site). | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ternary complex of human phosphoribosylglycinamidine synthase with the intermediate (iminophosphate) and ADP bound at the synthase site. | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9n9w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of AMPPNP bound human phosphoribosylformylglycinamidine synthase | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iaj | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Ala acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iak | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9ial | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with RNA microhelices mimicking tRNA-Glu acceptor arm | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iam | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of cyclodipeptide synthase from Nocardia brasiliensis (Nbra-CDPS) in complex with alanylated RNA microhelices analogues mimicking Ala-tRNA-Ala substrate | | Authors: | Marouf, F.Z., Charbonnier, J.B., Fernandez Varela, P., Legrand, P. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n92 | | Status: | HPUB -- hold until publication | | Title: | High-resolution analysis of the human T-cell leukemia virus capsid protein reveals insights into immature particle morphology | | Authors: | Arndt, W.G., Ramezani, A., Talledge, N., Yu, G., Yang, H., Chen, B., Zhang, W., Mansky, L.M., Perilla, J.R. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n97 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of an anti-HIV_scFv design with disulfide bonds eliminated | | Authors: | Chen, S.H., Snow, C.D., Deroo, J.B., Zhao, N. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SUDV glycoprotein with modified HR1c (L579P) and HR2 stalk bound to CA45 Fab | | Authors: | Lee, Y.Z., Ward, A.B., Zhu, J. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9n7w | | Status: | HPUB -- hold until publication | | Title: | antibody 5E10 Fab | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTFKLLIYYTSRLHSGVPSRFSGGGSGTDYSLTISNLEKEDIATYFCQQGNTLPRTFGGGTRLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
(PCA)VQLLQPGAELVRPGASVRLSCKTSGYTFTSYWINWVKQRPGQGLEWIGKIFPSDSHTNYNQKFKDKATLTVDKSSSTAYMQLISPTSEDSAVYYCTRDFDTQFYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
|
| PDBID: | 9i9c | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 29 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lsn | | Status: | HOLD -- hold until a certain date | | Title: | hAGO2-MID in complex with a chemical modified uridine monophosphate | | Authors: | Yao, Y.Q., Ma, J.B. | | Deposition date: | 2025-02-04 | | Release date: | 2026-02-04 |
|
| PDBID: | 9lso | | Status: | HOLD -- hold until a certain date | | Title: | hAGO2-MID in complex with a chemical modified uridine monophosphate | | Authors: | Yao, Y.Q., Ma, J.B. | | Deposition date: | 2025-02-04 | | Release date: | 2026-02-04 |
|
| PDBID: | 9lss | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of PDE5 with 1934 | | Authors: | Wu, D., Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2025-02-04 |
|
| PDBID: | 9n5z | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin CA09 homotrimer bound to AMB38310/AMB38599 Fab | | Authors: | Fernandez-Quintero, M.L., Raghavan, S.S.R., Gharpure, A., Turner, H.L., Ward, A.B. | | Deposition date: | 2025-02-04 |
|
