| PDBID: | 9i93 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Shigella flexneri LptDE bound by a Bicyclic peptide molecule (Compound 2) | | Authors: | Allyjaun, S., Newman, H., Dunbar, E., Hardwick, S.W., Chirgadze, D.Y., van den Berg, B., Hubbard, J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of macrolide phosphotransferase from Klebsiella pneumoniae | | Authors: | Si, Y., Wen, H., Peng, D. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lti | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of LH1-RC from Ery. sanguineus | | Authors: | Yue, X.-Y., Wang, G.-L., Yu, L.-J. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H-2Kb with C.parvum peptide | | Authors: | Fan, S.H., Wang, Y.L. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lt7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mSTING-TTB | | Authors: | Zhang, C.G., Hou, Y.F., Liu, P.Y., Fan, S.L. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltd | | Status: | HPUB -- hold until publication | | Title: | Human PKM2 complex with serine | | Authors: | Wang, J., Wu, C. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lte | | Status: | HPUB -- hold until publication | | Title: | Human PKM2 complex with methionine | | Authors: | Wang, J., Wu, C. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human RAB43 in complex with GppNHp | | Authors: | Wang, J., Yan, W.P. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
GGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVKLQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLIGNKSDLSELREVSLAEAQSLAEHYDILCAIETSAKDSSNVEEAFLRVATELIMRHGGPLFS
|
|
| PDBID: | 9ltj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lts | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human RAB43 in GDP-AlF3 transition state complex with USP6NL TBC domain | | Authors: | Wang, J., Yan, W.P. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lto | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9ltw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n6g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n67 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania braziliensis in complex with orotate | | Authors: | Froes, T.Q., Vaidergorn, M.M., Emery, F.S., Nonato, M.C. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
