| PDBID: | 9hrp | | Status: | HPUB -- hold until publication | | Title: | Structure of YIUA from Yersinia ruckeri with iron | | Authors: | Thompson, S., Thomsen, E., Duhme-Klair, A., Butler, A., Grogan, G. | | Deposition date: | 2024-12-18 | | Sequence: | >Entity 1
SENITDMAGRSVVIPAKVERILLGEGRLFYAVSLLEGQKPFDRIVGWQGDFRKLDTQTYAVYKAKFPQVDNIPLIGNTTADSISPEKVLTLNPDIAIFGLSGHGPGKNSELVKQLEKAGVPVVFVDFRTSPLKNTLPSMRVLGKVLHREQQANDYIKFYEDNVRKVTEITSKIPADKKPSVFIELRAGAMEECCGTAGKGNMGDFIDQAGGNNMAKNLLPGALGTVNLEKVLSTNPDIYIASGGKAPDNNAPGVSLGAQVTKEQAQSSLQTILDRKGINTLSAVKNGRSYGIWHNFYNSPYNVLAIQSFAKWFYPQQFADLDPNNTMNSLYSQFLAIEPTGTYWVDSTK
|
|
| PDBID: | 9hs4 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (double crosslink from Lys) | | Authors: | Pfalzgraf, H.E., Adams, H.R., Mikolajek, H., Sanchez-Weatherby, J., Sandy, J., Hough, M.A. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9hs6 | | Status: | HPUB -- hold until publication | | Title: | Cytochrome P460 from Methyloccocus capsulatus (double crosslink from Lys), aged | | Authors: | Pfalzgraf, H.E., Adams, H.R., Mikolajek, H., Sanchez-Weatherby, J., Sandy, J., Hough, M.A. | | Deposition date: | 2024-12-18 |
|
| PDBID: | 9l2i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of soluble methane monooxygenase hydroxylase from Methylosinus sporium 5 | | Authors: | Hwang, Y., Pozharski, E., Lee, S.J. | | Deposition date: | 2024-12-17 |
|
| PDBID: | 9hpz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the wild-type flagellar filament from Roseburia hominis | | Authors: | Bell, M.E.W., Koch, I., Hipp, K., Hartmann, M.D., Merino, F., Ley, R.E. | | Deposition date: | 2024-12-16 | | Release date: | 2025-12-16 |
|
| PDBID: | 9hpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of meropenem bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of avibactam bound to OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hpu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OXA-57 | | Authors: | Shaw, J.M., Bragginton, E.C., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqh | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 28-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 |
|
| PDBID: | 9hqf | | Status: | HPUB -- hold until publication | | Title: | SARM1 TIR domain in complex with compound 7-ADPR | | Authors: | Giroud, M., Kuhn, B., Steiner, S., Westwood, P., Mendel, M., Mani, A., Pinard, E., Haap, W., Grether, U., Caramenti, P., Rombach, D., Zambaldo, C., Ritter, M., Schmid, P., Gasser, C., Aregger, N., Sechet, N., Topp, A., Bilyard, M., Malnight-Alvarez, A., Plitzko, I., Hilbert, M., Kalayil, S., Burger, D., Bonardi, C., Saal, W., Haider, A., Wittwer, M., Brigo, A., Keaney, J., Benz, J. | | Deposition date: | 2024-12-16 | | Sequence: | >Entity 1
GGSSGSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQ
|
|
| PDBID: | 9hpl | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-galactosidase labeled with Chromeo P503 dye purified using MISO | | Authors: | Eluru, G., De Gieter, S., Stroobants, A., Efremov, R.G. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9hpm | | Status: | HPUB -- hold until publication | | Title: | E. coli beta-galactosidase labeled with Chromeo P503 dye purified using MISO from 1ug | | Authors: | Eluru, G., De Gieter, S., Stroobants, A., Efremov, R.G. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9hpo | | Status: | HPUB -- hold until publication | | Title: | Docedameric RuvBL1/RuvBL2 | | Authors: | Santo, P.E., Plisson-Chastang, C. | | Deposition date: | 2024-12-13 |
|
| PDBID: | 9mg5 | | Status: | HPUB -- hold until publication | | Title: | Structure of Saccharomyces cerevisiae mRNA cap (guanine-N7) methyltransferase, Abd1, in complex with sinefungin and GTP | | Authors: | Nilson, D.J., Fedorov, E., Ghosh, A. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9hnj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR solution structure of OrfM from ICESt3 of Streptococcus thermophilus | | Authors: | Tsan, P., Cappele, J., Laroussi, H., Clement, E., Favier, F., Didierjean, C., Soler, N., Leblond-Bourget, N. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9mg0 | | Status: | HPUB -- hold until publication | | Title: | Structure of Kluyveromyces lactis mRNA cap (guanine-N7) methyltransferase, Abd1, in complex with SAH | | Authors: | Nilson, D.J., Fedorov, E., Ghosh, A. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9mg1 | | Status: | HPUB -- hold until publication | | Title: | Structure of Kluyveromyces lactis mRNA cap (guanine-N7) methyltransferase, Abd1, in complex with adenine and m7GTP | | Authors: | Nilson, D.J., Fedorov, E., Ghosh, A. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9mg2 | | Status: | HPUB -- hold until publication | | Title: | Structure of Kluyveromyces lactis mRNA cap (guanine-N7) methyltransferase, Abd1, in complex with sinefungin | | Authors: | Nilson, D.J., Fedorov, E., Ghosh, A. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9mg3 | | Status: | HPUB -- hold until publication | | Title: | Structure of Kluyveromyces lactis mRNA cap (guanine-N7) methyltransferase, Abd1, in complex with sinefungin and GTP | | Authors: | Nilson, D.J., Fedorov, E., Ghosh, A. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9mg4 | | Status: | HPUB -- hold until publication | | Title: | Structure of Saccharomyces cerevisiae mRNA cap (guanine-N7) methyltransferase, Abd1, in complex with SAH | | Authors: | Nilson, D.J., Fedorov, E., Ghosh, A. | | Deposition date: | 2024-12-10 |
|
| PDBID: | 9kyc | | Status: | HPUB -- hold until publication | | Title: | PltBd1/PltBd2 heteropentameric holotoxin from E. coli | | Authors: | Chen, Z., Wang, D.D., Gao, X. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9kyd | | Status: | HPUB -- hold until publication | | Title: | PltBd1 homopentameric holotoxin from E. coli | | Authors: | Chen, Z., Wang, D.D., Gao, X. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9kye | | Status: | HPUB -- hold until publication | | Title: | PltBd2 homopentameric holotoxin from E. coli | | Authors: | Chen, Z., Wang, D.D., Gao, X. | | Deposition date: | 2024-12-08 |
|
| PDBID: | 9ky9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli tryptophanyl-tRNA synthetase complexed with 3-methylchuangxinmycin and tryptophanyl-5''-AMP | | Authors: | Ren, Y., Wang, S., Liu, W., Fang, P. | | Deposition date: | 2024-12-08 |
|
