Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:9o5j
Status:HPUB -- hold until publication
Title:Human Aconitate Decarboxylase I apo form
Authors:Runge, B.R., Monteiro, D.C.F.
Deposition date:2025-04-10
PDBID:9uf6
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of BA1-1-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9ufd
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of BA12-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9uff
Status:HPUB -- hold until publication
Title:Cryo-EM structure of BA21-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9ufl
Status:HPUB -- hold until publication
Title:Cryo-EM structure of BA22-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9ufs
Status:HPUB -- hold until publication
Title:Cryo-EM structure of BA23-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9ufx
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of HA11-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9ufy
Status:HPUB -- hold until publication
Title:Cryo-EM structure of HA21-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9o5n
Status:HPUB -- hold until publication
Title:Human Aconitate Decarboxylase I bound to citraconate
Authors:Runge, B.R., Monteiro, D.C.F.
Deposition date:2025-04-10
PDBID:9ug0
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of HA31-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9ug1
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of HA32-bound alpha-synuclein fibril polymorph 6A6B
Authors:Zhang, S.Q., Liu, C., Li, D.
Deposition date:2025-04-10
PDBID:9ue8
Status:HPUB -- hold until publication
Title:Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345
Authors:Sun, D., Zhang, N., Guo, Y.
Deposition date:2025-04-08
PDBID:9qsw
Status:HPUB -- hold until publication
Title:Crystal structure of an NtA622L variant in complex with NADP+ and Nicotinic acid
Authors:Mokos, D., Daniel, B.
Deposition date:2025-04-07
PDBID:9qst
Status:HPUB -- hold until publication
Title:Protein Kinase CK2 and bivalent inhibitors
Authors:Krimm, I., Gelin, M., Guichou, J.F., Grenier, D.
Deposition date:2025-04-07
Sequence:

>Entity 1


MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
PDBID:9o39
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of the E. coli HtpG N-terminal and middle domain dimer in complex with AMPPNP
Authors:Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y.
Deposition date:2025-04-07
Release date:2026-04-07
PDBID:9o3c
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state
Authors:Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y.
Deposition date:2025-04-07
Release date:2026-04-07
PDBID:9o3a
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state
Authors:Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y.
Deposition date:2025-04-07
Release date:2026-04-07
PDBID:9o3r
Status:HPUB -- hold until publication
Title:Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT)
Authors:Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G.
Deposition date:2025-04-07
Sequence:

>Entity 1


PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
PDBID:9udq
Status:HPUB -- hold until publication
Title:Crystal structure of MPXV A35R in complex with a neutralizing antibody MA42
Authors:Sun, D., Zhang, N., Guo, Y.
Deposition date:2025-04-07
PDBID:9ue0
Status:HPUB -- hold until publication
Title:Crystal structure of MPXV A35R in complex with a neutralizing antibody MA49
Authors:Sun, D., Zhang, N., Guo, Y.
Deposition date:2025-04-07
PDBID:9qsp
Status:HPUB -- hold until publication
Title:Crystal structure of Zika Virus NS2B-NS3 protease in complex with Z2242050769
Authors:Benz, L.S., Becker, F., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O.
Deposition date:2025-04-06
PDBID:9qsm
Status:HPUB -- hold until publication
Title:small molecule inhibitor in complex with PD-L1
Authors:Muszak, D., Kocik-Krol, J., Zaber, J., Kruc, O., Palej, U., Fijolkowska, K., Maslanka, A., Magiera-Mularz, K., Plewka, J., Stec, M., Siedlar, M., Musielak, B., Kitel, R., Skalniak, L., Surmiak, E.
Deposition date:2025-04-05
PDBID:9qsj
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of SKM-70S ribosomal stalled complex in the A-tRNA positioned (Body open) state.
Authors:Morici, M., Corazza, M., Safdari, H.A., Wilson, D.N.
Deposition date:2025-04-05
PDBID:9qsk
Status:HPUB -- hold until publication
Title:Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z741560256
Authors:Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O.
Deposition date:2025-04-05
PDBID:9qsl
Status:HPUB -- hold until publication
Title:Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z4666192264
Authors:Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O.
Deposition date:2025-04-05

242842

数据于2025-10-08公开中

PDB statisticsPDBj update infoContact PDBjnumon