| PDBID: | 9o5j | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I apo form | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uf6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of BA1-1-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of BA12-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9uff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA21-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA22-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufs | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BA23-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA11-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ufy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HA21-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5n | | Status: | HPUB -- hold until publication | | Title: | Human Aconitate Decarboxylase I bound to citraconate | | Authors: | Runge, B.R., Monteiro, D.C.F. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ug0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA31-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ug1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of HA32-bound alpha-synuclein fibril polymorph 6A6B | | Authors: | Zhang, S.Q., Liu, C., Li, D. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9ue8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qsw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of an NtA622L variant in complex with NADP+ and Nicotinic acid | | Authors: | Mokos, D., Daniel, B. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qst | | Status: | HPUB -- hold until publication | | Title: | Protein Kinase CK2 and bivalent inhibitors | | Authors: | Krimm, I., Gelin, M., Guichou, J.F., Grenier, D. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
MHHHHHHSSGVDLGTENLYFQSMSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSS
|
|
| PDBID: | 9o39 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the E. coli HtpG N-terminal and middle domain dimer in complex with AMPPNP | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9udq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA42 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9ue0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA49 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Zika Virus NS2B-NS3 protease in complex with Z2242050769 | | Authors: | Benz, L.S., Becker, F., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-06 |
|
| PDBID: | 9qsm | | Status: | HPUB -- hold until publication | | Title: | small molecule inhibitor in complex with PD-L1 | | Authors: | Muszak, D., Kocik-Krol, J., Zaber, J., Kruc, O., Palej, U., Fijolkowska, K., Maslanka, A., Magiera-Mularz, K., Plewka, J., Stec, M., Siedlar, M., Musielak, B., Kitel, R., Skalniak, L., Surmiak, E. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9qsj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SKM-70S ribosomal stalled complex in the A-tRNA positioned (Body open) state. | | Authors: | Morici, M., Corazza, M., Safdari, H.A., Wilson, D.N. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9qsk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z741560256 | | Authors: | Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-05 |
|
| PDBID: | 9qsl | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Mycobacterium smegmatis thioredoxin reductase in complex with Z4666192264 | | Authors: | Becker, F., Benz, L.S., Janssen, P., Fuesser, F.T., Weiss, M.S., Kuemmel, D., Koch, O. | | Deposition date: | 2025-04-05 |
|
