| PDBID: | 9o5e | | Status: | HPUB -- hold until publication | | Title: | The dimeric KICSTOR-GATOR1 supercomplex | | Authors: | Bayly-Jones, C., Lupton, C.J., Chang, Y.G., Ellisdon, A.M. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9o5g | | Status: | HPUB -- hold until publication | | Title: | Room-temperature joint X-ray/Neutron structure of Thermus thermophilus SHMT in complex with PLP-Gly external aldimine and 5-methyl-tetrahydrofolate (5MTHF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9o5r | | Status: | HPUB -- hold until publication | | Title: | VAR2CSA in complex with V2C.044 Fab | | Authors: | Raghavan, S.S.R., Ward, A.B. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quf | | Status: | HPUB -- hold until publication | | Title: | Structure of a fungal Ube2O | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qu8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apPol-DNA-nucleotide complex (ternary2) | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qug | | Status: | HPUB -- hold until publication | | Title: | Structure of a UBC-Ubiquitin conjugate | | Authors: | Kordic, D., Williams, T.L., Luiza Deszcz, L., Ehrmann, J., Arnese, R., Meinhart, A., Clausen, T. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qua | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apPol-DNA-nucleotide complex (ternary 1) | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quc | | Status: | HPUB -- hold until publication | | Title: | Metal-free de novo protein scaffold TFD-EH | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATITLSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
| PDBID: | 9quj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apPol-DNA complex (binary 1) | | Authors: | Lahiri, I., Kumari, A. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qui | | Status: | HOLD -- hold until a certain date | | Title: | Ni(II)-bound de novo protein scaffold TFD-EH | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATITLSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
| PDBID: | 9quk | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of human MTH1 in complex with 8DG by MicroED using low electron fluence | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9qum | | Status: | HPUB -- hold until publication | | Title: | Structure of lysozyme by continuous serial electron diffraction (SerialED) | | Authors: | Hofer, G., Wang, L., Pacoste, L., Hager, P., Fonjallaz, A., Scaletti Hutchinson, E., Stenmark, P., Di Palma, M., Williams, L., Worral, J., Steiner, R., Xu, H., Zou, X. | | Deposition date: | 2025-04-10 |
|
| PDBID: | 9quo | | Status: | HOLD -- hold until a certain date | | Title: | Co(II)-bound de novo protein scaffold TFD-EH T87E | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 | | Sequence: | >Entity 1
GAMGDILIVWAKDVDEMLKQVEILRRLGAKQIAVESSDWRILQEALKKGGDILIVNGGGMTITFRGDDLEALLKAAIEMIKQALKFGATIELSLDGNDLNINITGVPEQVRKELAKEAERLAKEFGITVTRTGGGDVDEMLKQVEILRRLGAKQIAVHSDDWRILQEALKKG
|
|
| PDBID: | 9qup | | Status: | HOLD -- hold until a certain date | | Title: | Tb(III)-bound de novo protein scaffold TFD-EE MPNN | | Authors: | Wagner Egea, P., Delhommel, F., Mustafa, G., Leiss-Maier, F., Klimper, L., Badmann, T., Heider, A., Wille, I.C., Groll, M., Sattler, M., Zeymer, C. | | Deposition date: | 2025-04-10 | | Release date: | 2026-04-10 | | Sequence: | >Entity 1
MMTFIVWALNKDEMLKNIEALRKAGAKNIAVESGDFDILRAAIEAGVETIVVSGGGLTIVFTGADRAALRRAAKRLLDAALELGAVVTVALDGDALRVRITGVPEQDLERLRALARELAAEFGIEVEVRGGGTPERALREIQELRELGAKNIWVESANVDWLLKLLKLS
|
|
| PDBID: | 9o5b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RNase A in complex with N1-Methylpseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9o50 | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of Thermus thermophilus SHMT in complex with tetrahydrofolate (THF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-09 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTH(LLP)TLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9uef | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of AvmO1 mutant - Y282R+V352L and Alchivemycin A | | Authors: | Guo, N., Dong, H., Han, Y., Yang, J., Lei, X. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9ue8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody BA345 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | RNase A in complex with Pseudouridine Vanadate and decavanadates | | Authors: | Gutierrez, C.S., Lim, D.C., Silkenath, B., Kojasoy, V., Raines, R.T. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o4t | | Status: | HPUB -- hold until publication | | Title: | RT XFEL structure of Soybean Lipoxygenase-1 in large unit-cell | | Authors: | Wolff, A.M., Thompson, M.C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9o47 | | Status: | HPUB -- hold until publication | | Title: | RNA dodecamer containing a serinol nucleic acid. | | Authors: | Harp, J.M., Egli, M.E. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt8 | | Status: | HPUB -- hold until publication | | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-P155G | | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtb | | Status: | HPUB -- hold until publication | | Title: | Apo form of the L-protein from Rift Valley Fever Virus (LPapo) | | Authors: | Kral, M., Das, A.R., Kotacka, T., Blahosova, A., Hodek, J., Konvalinka, J., Demo, G., Kozisek, M. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qtd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytoplasmic 60S maturation intermediate (State D1) | | Authors: | Kargas, V., Warren, A.J. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9qt7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer | | Authors: | Morozov, V., Wang, L., Kwon, S., Douat, C., Huc, I. | | Deposition date: | 2025-04-08 |
|
