| PDBID: | 9jyy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jyz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | portal-tail complex of mature T7 | | Authors: | Liu, H.R., Chen, W.Y. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jz0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | portal-tail complex of DNA-ejected T7 | | Authors: | Liu, H.R., Chen, W.Y. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jz1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jyw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the gamma-carbonic anhydrase from the polyextremophilic bacterium Aeribacillus pallidus | | Authors: | Choi, S.H., Jin, M.S. | | Deposition date: | 2024-10-13 |
|
| PDBID: | 9jz2 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9jz3 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 8 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9jz4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9jz5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 9 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-10-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9h2m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy3 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of C4-Dicarboxylate-Binding Periplasmic Protein (PA5167) of Tripartite ATP-independent Periplasmic Transporter Family from Pseudomonas aeruginosa PAO1 in Complex with L-Malate | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-10-12 | | Sequence: | >Entity 1
SNAADPIVIKFSHVVAEHTPKGQGALLFKKLVEERLPGKVKVEVYPNSSLFGDGKE(MSE)EALLLGDVQIIAPSLAKFEQYTKKLQIFDLPFLFDNIQAVDRFQQSPQGKELLTS(MSE)QDKGITGLGYWHNG(MSE)KQLSANKPLREPKDARGLKFRVQASKVLEEQFKAVRANPRK(MSE)SFAEVYQGLQTGVVNGTENPWSNIYSQK(MSE)HEVQKYITESDHGVLDY(MSE)VITNTKFWNGLPEDVRGVLAKT(MSE)DEVTVEVNKQAEALNQGDKQRIVEAKTSEIIELTPEQRAEWRKA(MSE)QPVWKKFEGEIGADLIKAAEAANQAQ
|
|
| PDBID: | 9jy5 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA1 | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy6 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy1 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA2.1 | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxz | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Methyladenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in state EA2.1_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy2 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with 2''-Deoxyadenosine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jy9 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-inhibited state SB_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxy | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with ADP | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jya | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-inhibited state SD4.0_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dy0 | | Status: | HPUB -- hold until publication | | Title: | Human PDK1 kinase domain in complex with N6-Dimethyladenine | | Authors: | Gross, L.Z.F., Klinke, S., Biondi, R.M. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9jyb | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of USP14(C114A)-bound human 26S proteasome in substrate-engaged state ED0.0_USP14ca | | Authors: | Zou, S., Zhang, S., Mao, Y. | | Deposition date: | 2024-10-12 |
|
| PDBID: | 9dxx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the A/Puerto Rico/8/1934 (H1N1) influenza virus hemagglutinin in complex with D-peptide | | Authors: | Kadam, R.U., Wilson, I.A. | | Deposition date: | 2024-10-12 |
|
