| PDBID: | 9rjq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [FeFe]-hydrogenase CpI from Clostridium pasteurianum, variant Q195L | | Authors: | Duan, J., Liu, L., Hofmann, E., Happe, T. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9p35 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Artemia ferritin in cell-free lysate with reverse His purification | | Authors: | Powell, S.M., Evans, J.E. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9p25 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 at 0.89 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p26 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 at 1.40 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Madelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p27 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 at 1.33 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p28 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with laminaritriose at 1.30 angstrom resolution. | | Authors: | Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p29 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with laminaripentaose at 1.48 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with laminaripentaose at 1.45 angstrom resolution | | Authors: | Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with laminarihexaose at 1.62 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with laminarihexaose at 1.31 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 at 1.30 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G3G4G) oligosaccharide at 1.70 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G) oligosaccharide at 1.15 angstrom resolution | | Authors: | Martins, M.P., Spadeto, J.P.M., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2g | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G4G3G) oligosaccharide at 1.10 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G4G3G) oligosaccharide at 1.30 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.25 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.40 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 soaked with mixed linkage (G4G3G4G) oligosaccharide at 1.30 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 at 1.10 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Santos, C.A., Santos, C.R., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p2m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ProGH158 at 1.42 angstrom resolution | | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9rib | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of C273S mutant of mouse CDC14A | | Authors: | Shabbir, K., Jackisch, G., Knecht, W., Wilson, E., Dong, L., Friedman, T.B., Imtiaz, A., Logan, D.T. | | Deposition date: | 2025-06-11 |
|
| PDBID: | 9p1q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Ube2E3 | | Authors: | Cook, M.W., Brzovic, P.S., Stenkamp, R.E. | | Deposition date: | 2025-06-10 | | Sequence: | >Entity 1
MTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
|
|
| PDBID: | 9p1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Staphylococcus aureus ClpP in complex with chimerabactin | | Authors: | Lee, R.E., Griffith, E.C. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p1i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Atomic structure of vibrio effector fragment VopV bound to Beta-cytoplasmic/gamma1-cytoplasmic F-actin | | Authors: | Kreutzberger, M.A., Kudryashova, E., Egelman, E.H., Kudryashov, D.S. | | Deposition date: | 2025-06-10 |
|
| PDBID: | 9p13 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lysozyme in situ room temperature on site | | Authors: | Snell, M.E., Campomizzi, C.S., Mikolajek, H., Sandy, J., Sanchez-Weatherby, J., Budziszewski, G.R., Hough, M.A., Bowman, S.E.J. | | Deposition date: | 2025-06-09 |
|
