| PDBID: | 9oje | | Status: | HPUB -- hold until publication | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with 5-bromo picolinic acid | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r49 | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Human insulin, pH 4.5 (25 ms soaking) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r4a | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Human insulin, pH 4.5 (50 ms soaking) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r4c | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Human insulin, pH 4.5 (500 ms soaking) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r4e | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Human insulin, pH 4.5 (5 s soaking) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r4b | | Status: | HPUB -- hold until publication | | Title: | SPITROBOT-2 advances time-resolved cryo-trapping crystallography to under 25 ms: Human insulin, pH 4.5 (250 ms soaking) | | Authors: | Spiliopoulou, M., Hatton, C.E., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r41 | | Status: | HPUB -- hold until publication | | Title: | Buspirone-bound serotonin 5-HT1A receptor - Gi Protein Complex | | Authors: | Schneider, J., Gmeiner, P., Boettcher, B. | | Deposition date: | 2025-05-07 |
|
| PDBID: | 9r3j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human MAO B in complex with (E)-3-(benzo[d][1,3]dioxol-5-yl)-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (chalcone inhibitor, 4e) | | Authors: | Marchese, S., Binda, C. | | Deposition date: | 2025-05-05 |
|
| PDBID: | 9ocm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with (E)-5-(3-(4-nitrophenyl)allylidene)pyrimidine-2,4,6(1H,3H,5H)-trione | | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | | Deposition date: | 2025-04-24 |
|
| PDBID: | 9obb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dihydroorotate dehydrogenase from Leishmania brasiliensis in complex with 5-[(E)-3-(p-methoxyphenyl)-2-propenylidene]-2,4,6(1H,3H,5H)-pyrimidinetrione | | Authors: | Vaidergorn, M.M., Nonato, M.C., Froes, T.Q., Augusto, B.S. | | Deposition date: | 2025-04-22 |
|
| PDBID: | 9oat | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | TNA polymerase, 5-270, binary complex | | Authors: | Lee, J.J., Maola, V.A., Barpuzary, B., Chim, N., Chaput, J.C. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9oax | | Status: | AUCO -- author corrections pending review | | Title: | TNA polymerase, 5-270, ternary complex | | Authors: | Lee, J.J., Maola, V.A., Chim, N., Chaput, J.C. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9o94 | | Status: | HPUB -- hold until publication | | Title: | Transporter associated with antigen processing (TAP) EQ mutant bound to the viral protein bUL49.5 in the outward-facing kinked state | | Authors: | Lee, J., Manon, V., Chen, J. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9o9d | | Status: | HPUB -- hold until publication | | Title: | Transporter associated with antigen processing (TAP) EQ mutant bound to the viral protein bUL49.5 in the outward-facing unkinked state | | Authors: | Lee, J., Manon, V., Chen, J. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9o75 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 I253M at pH 6.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-14 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9o64 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of IgG1 FC I253M at pH 5.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9o5g | | Status: | HPUB -- hold until publication | | Title: | Room-temperature joint X-ray/Neutron structure of Thermus thermophilus SHMT in complex with PLP-Gly external aldimine and 5-methyl-tetrahydrofolate (5MTHF) | | Authors: | Kovalevsky, A., Drago, V.N., Phillips, R.S. | | Deposition date: | 2025-04-10 | | Sequence: | >Entity 1
STLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPMP
|
|
| PDBID: | 9uf2 | | Status: | HPUB -- hold until publication | | Title: | CTP synthase PRE-state 5 | | Authors: | Guo, C.J. | | Deposition date: | 2025-04-09 |
|
| PDBID: | 9ubo | | Status: | HPUB -- hold until publication | | Title: | The structure of type III CRISPR-associated deaminase in complex cA6 and ATP, state 5 | | Authors: | Kong, J.P., Wu, W.Q., Li, Z.X., Xiao, Y.B. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9nzm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GMPPNP and Covalently Bound to an Adduct of {(2S)-4-[7-(8-chloronaphthalen-1-yl)-2-{[(2S)-1-methylpyrrolidin-2-yl]methoxy}-5,6,7,8-tetrahydropyrido[3,4-d]pyrimidin-4-yl]-1-[(2Z)-2-fluoro-3-(pyridin-2-yl)prop-2-enoyl]piperazin-2-yl}acetonitrile | | Authors: | Sheriff, S., Pokross, M., Witmer, M. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9u8r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TTPP and 6-amino-4-oxo-4,5-dihydro-1,3,5-triazine-2-carboxylic acid. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9u8s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiamine pyrophosphate (TPP)-dependent alpha-imino acid decarboxylase (AzcB and AzcC) from Streptomyces mobaraensis in complex with TPP and 5-azacytosine. | | Authors: | Nakashima, Y., Tsunoda, T., Ogasawara, Y., Dairi, T., Morita, H. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qlw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | NMR2 Structure of KRAS G12V (GDP bound) in complex with 2-((1H-indol-3-yl)methyl)-1H-benzo[d]imidazol-5-amine | | Authors: | Buetikofer, M., Orts, J. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qkb | | Status: | HPUB -- hold until publication | | Title: | NCS-1 bound to XChem ligand 5 | | Authors: | Munoz-Reyes, D., Sanchez-Barrena, M.J. | | Deposition date: | 2025-03-19 |
|
